Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/13604
Proper Citation: RRID:Addgene_13604
Insert Name: integrin alpha 9
Organism: Homo sapiens
Bacterial Resistance: Ampicillin
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites. An ITGA5 signal peptide sequence (MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLVPPPPRVGG) is present immediately before the start of ITGA9 at amino acid 30.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for integrin alpha9 pBabe puro.
No alerts have been found for integrin alpha9 pBabe puro.
Source: Addgene