Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/162821
Proper Citation: RRID:Addgene_162821
Insert Name: Ub-(N-TAG)CoV2_ORF3b_alt
Organism: SARS-CoV-2
Bacterial Resistance: Ampicillin
Defining Citation: PMID:33175524
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Comments: Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
Check
for all resource mentions.
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b_alt .
No alerts have been found for pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b_alt .
Source: Addgene
