Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/217673
Proper Citation: RRID:Addgene_217673
Insert Name: CRYGS
Organism: Homo sapiens
Bacterial Resistance: Kanamycin
Vector Backbone Description: Backbone Size:5368; Vector Backbone:pET28B+; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: This a N-terminally truncated gamma S crystallin missing its N-terminal 15 amino acid residues and containing a Q16C mutation at its N-terminus to act as a site to perform native chemical ligation. It also has a N-terminal SUMO tag with a 6X His tag with the amino acid sequence: GHHHHHHGSLQDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQ IGG It will express in a soluble state with the SUMO tag, but will precipitate once the SUMO tag is removed during ulp-1 cleavage. It has a propensity to form non-disulfide linked multimers once the SUMO tag is removed, so the ligation reaction must be performed immediately after ULP-1 treatment.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
Check
for all resource mentions.
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for SUMO CRYGS 16-177 Q16C.
No alerts have been found for SUMO CRYGS 16-177 Q16C.
Source: Addgene
