Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
CD11c antibody [3.9] Resource Report Resource Website 1+ mentions Rating or validation data |
Abcam Cat# ab11029, RRID:AB_297683 | CD11c | rat, mouse, human | Clone 3.9 |
validation status unknown, seller recommendations provided in 2012: Flow Cytometry; Immunohistochemistry; Immunoprecipitation; Flow Cytometry, Immunohistochemistry-Fr, Immunoprecipitation Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_297683 | Abcam | ab11029 | 2025-08-19 11:25:54 | 7 | |
|
Anti-Tenascin, clone DB7 Resource Report Resource Website Rating or validation data |
Millipore Cat# MAB19101, RRID:AB_94402 | Tenascin clone DB7 | h, gp, rb, rabbit |
seller recommendations: IgG2a; IgG2a IF, WB, IH(P); Immunofluorescence; Immunohistochemistry; Western Blot Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_94402 | Millipore | MAB19101 | 2025-08-19 11:25:51 | 0 | ||
|
Anti-NCBP2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044850, RRID:AB_10961012 | NCBP2 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10961012 | Sigma-Aldrich | HPA044850 | 2025-08-19 11:20:43 | 0 | |||
|
Anti-CALCRL antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA008070, RRID:AB_1845912 | CALCRL antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1845912 | Sigma-Aldrich | HPA008070 | 2025-08-19 11:20:46 | 0 | ||
|
Anti-IL17REL antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045546, RRID:AB_10963836 | IL17REL antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10963836 | Sigma-Aldrich | HPA045546 | 2025-08-19 11:20:42 | 0 | |||
|
Anti-FAM36A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043617, RRID:AB_10965694 | FAM36A antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10965694 | Sigma-Aldrich | HPA043617 | 2025-08-19 11:20:30 | 0 | |||
|
Anti-NECAB1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA025963, RRID:AB_1848015 | NECAB1 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1848015 | Sigma-Aldrich | HPA025963 | 2025-08-19 11:20:41 | 0 | ||
|
Anti-TNFSF18 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012699, RRID:AB_1849698 | TNFSF18 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_1849698 | Atlas Antibodies | HPA012699 | 2025-08-19 11:21:06 | 0 | ||
|
Anti-DPYSL2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA002381, RRID:AB_1847244 | Human DPYSL2 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847244 | Sigma-Aldrich | HPA002381 | 2025-08-19 11:21:12 | 0 | ||
|
Anti-ADPRHL2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA027141, RRID:AB_1844619 | Human ADPRHL2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1844619 | Sigma-Aldrich | HPA027141 | 2025-08-19 11:21:09 | 0 | ||
|
Anti-TMEM146 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA024056, RRID:AB_1858093 | Human TMEM146 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1858093 | Sigma-Aldrich | HPA024056 | 2025-08-19 11:21:15 | 0 | ||
|
Anti-KCNQ5 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA016655, RRID:AB_1855557 | Human KCNQ5 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1855557 | Sigma-Aldrich | HPA016655 | 2025-08-19 11:21:09 | 0 | ||
|
Anti-LMBRD1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA019547, RRID:AB_2281256 | LMBRD1 | human | Useful for immunohistochemistry | polyclonal | rabbit | AB_2281256 | Sigma-Aldrich | HPA019547 | 2025-08-19 11:21:35 | 0 | ||
|
Mouse Anti-Gelsolin Monoclonal Antibody, Unconjugated, Clone GS-2C4 Resource Report Resource Website Rating or validation data |
Abcam Cat# ab11081, RRID:AB_297732 | Gelsolin | porcine, cow, rabbit, bovine, human | Clone GS-2C4 |
Applications: Affinity purification, ELISA, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Fr, Other, Western Blot Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4724188 |
monoclonal | mouse | AB_297732 | Abcam | ab11081 | 2025-08-19 11:25:32 | 0 | |
|
Anti-ANKRD2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040842, RRID:AB_10963794 | ANKRD2 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10963794 | Sigma-Aldrich | HPA040842 | 2025-08-19 11:26:00 | 0 | |||
|
ANTI-APPL1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA011138, RRID:AB_1844959 | ANTI-APPL1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Western Blot; Immunofluorescence; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1844959 | Sigma-Aldrich | HPA011138 | 2025-08-19 11:25:59 | 0 | ||
|
Anti-EFHA1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA045511, RRID:AB_10959894 | EFHA1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10959894 | Sigma-Aldrich | HPA045511 | 2025-08-19 11:25:53 | 2 | |||
|
Anti-HSPBAP1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044930, RRID:AB_10961122 | HSPBAP1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10961122 | Sigma-Aldrich | HPA044930 | 2025-08-19 11:25:52 | 0 | |||
|
Anti-ARIH1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA003295, RRID:AB_1845017 | ARIH1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845017 | Atlas Antibodies | HPA003295 | 2025-08-19 11:25:59 | 0 | ||
|
Anti-ENPEP antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA005128, RRID:AB_1844795 | Human ENPEP | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1844795 | Sigma-Aldrich | HPA005128 | 2025-08-19 11:25:59 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
