Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2126328
Comments: Applications: Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Frozen
Host Organism: Mouse
Clonality monoclonal
Target(s): HPi1
Proper citation: Novus Cat# NBP1-18872B, RRID:AB_2126328 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603256
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC17816 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): HOMEZ
Proper citation: Sigma-Aldrich Cat# SAB2101060, RRID:AB_10603256 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851117
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): EFCAB6
Proper citation: Atlas Antibodies Cat# HPA018946, RRID:AB_1851117 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669652
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ADORA3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028566, RRID:AB_10669652 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672646
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CNPY2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038466, RRID:AB_10672646 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078983
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human GRIA2
Proper citation: Sigma-Aldrich Cat# HPA008441, RRID:AB_1078983 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079915
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human SERPINA7
Proper citation: Sigma-Aldrich Cat# HPA002803, RRID:AB_1079915 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_449014
Comments: Used By NYUIHC-1293
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): Synthetic peptide: VQIHILKADKAG, corresponding to amino acids 497 - 508 of Mouse Netrin
Proper citation: Abcam Cat# ab26162, RRID:AB_449014 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1999022
Comments: Discontinued; Applications: IP (5-15 µg/mg lysate), IHC (1:500-1:2,000), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): RECQ5
Proper citation: Thermo Fisher Scientific Cat# A302-520A, RRID:AB_1999022 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_805803
Comments: Applications: IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): MOF/MYST1
Proper citation: Bethyl Cat# A300-993A, RRID:AB_805803 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335786
Comments: Used By NYUIHC-204
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): ND
Proper citation: New York University; New York; USA Cat# JW002, RRID:AB_2335786 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616109
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): br
Proper citation: Jean-Antoine Lepseant Cat# non-commercial br modENCODE antibody 1, RRID:AB_2616109 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599707
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VIPAS39
Proper citation: Atlas Antibodies Cat# HPA003589, RRID:AB_10599707 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616307
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): lov
Proper citation: Pacific Immunology Cat# non-commercial lov modENCODE antibody 1, RRID:AB_2616307 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682597
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMCO1
Proper citation: Atlas Antibodies Cat# HPA054768, RRID:AB_2682597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600773
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PKDCC
Proper citation: Atlas Antibodies Cat# HPA026427, RRID:AB_10600773 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680402
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ATP5H
Proper citation: Atlas Antibodies Cat# HPA048459, RRID:AB_2680402 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683520
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GKN2
Proper citation: Atlas Antibodies Cat# HPA057765, RRID:AB_2683520 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2671385
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RANBP2
Proper citation: Atlas Antibodies Cat# HPA023960, RRID:AB_2671385 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683958
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HSHCTEMQRLLPKLEMLTLGSSFCSLQGEFCQAMDSFTTVSHVGMCEETDASFNVFSPKFQFDRSHCQSLRFHQNMELDFGHFDERDKTSRNMR; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): DCX
Proper citation: Atlas Antibodies Cat# HPA059243, RRID:AB_2683958 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
