Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 114 showing 2261 ~ 2280 out of 55,391 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2120669

Comments: manufacturer recommendations: IgG ELISA; Western Blot; WB, IHC; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615130, AB_2120669.
Host Organism: rabbit
Clonality unknown
Target(s): HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) (against the middle region of HNRPDL) (100ug)

Proper citation: Aviva Systems Biology Cat# ARP40585_T100, RRID:AB_2120669 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845403

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BNIP2

Proper citation: Atlas Antibodies Cat# HPA026843, RRID:AB_1845403 Copy   


  • RRID:AB_2683859

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683859

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): KRT25

Proper citation: Atlas Antibodies Cat# HPA058943, RRID:AB_2683859 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078253

Comments: Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): B4GALNT1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA008968, RRID:AB_1078253 Copy   


  • RRID:AB_1844265

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844265

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 07135-1A3 for not specified; status is not pursued
Host Organism: mouse
Clonality monoclonal
Target(s): ZFP36L1

Proper citation: Sigma-Aldrich Cat# WH0000677M2, RRID:AB_1844265 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080003

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC27A3

Proper citation: Atlas Antibodies Cat# HPA006935, RRID:AB_1080003 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848316

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human EXOC7

Proper citation: Sigma-Aldrich Cat# HPA022840, RRID:AB_1848316 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847632

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DGCR2

Proper citation: Sigma-Aldrich Cat# HPA000873, RRID:AB_1847632 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079066

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human HLX1

Proper citation: Sigma-Aldrich Cat# HPA005968, RRID:AB_1079066 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10891442

Comments: Applications: W, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): Phospho-FAK (Tyr397) (D20B1) Rabbit mAb

Proper citation: Cell Signaling Technology Cat# 8556, RRID:AB_10891442 Copy   


  • RRID:AB_10720162

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10720162

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40373 for K562,MCF-7,HEK293T; status is awaiting lab characterization,pending dcc review
Host Organism: rabbit
Clonality polyclonal
Target(s): FOXM1

Proper citation: GeneTex Cat# GTX102170, RRID:AB_10720162 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2728728

Comments: for use in western blotting (WB) & Chromatin immunoprecipitation (ChIP). original provider is Merck
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): Histone H3.3, K27M mutant

Proper citation: Millipore Cat# ABE419, RRID:AB_2728728 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682705

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC28A

Proper citation: Atlas Antibodies Cat# HPA055125, RRID:AB_2682705 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671507

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQRE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): HRH4

Proper citation: Atlas Antibodies Cat# HPA035009, RRID:AB_10671507 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10962977

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LMNTD1

Proper citation: Atlas Antibodies Cat# HPA045911, RRID:AB_10962977 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682928

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SERPINE3

Proper citation: Atlas Antibodies Cat# HPA055804, RRID:AB_2682928 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682492

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ICE1

Proper citation: Atlas Antibodies Cat# HPA054452, RRID:AB_2682492 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078126

Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): ALDH9A1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA010873, RRID:AB_1078126 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10959461

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): THOC3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045071, RRID:AB_10959461 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10959380

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): ABHD1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044390, RRID:AB_10959380 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X