Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) Antibody (against the middle region of HNRPDL) (100ug) Resource Report Resource Website Rating or validation data |
Aviva Systems Biology Cat# ARP40585_T100, RRID:AB_2120669 | HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) (against the middle region of HNRPDL) (100ug) | chicken, rat, xenopusamphibian, canine, mouse, chickenbird, zebrafishfish, bovine, zebrafish, human, dog | manufacturer recommendations: IgG ELISA; Western Blot; WB, IHC; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615130, AB_2120669. | unknown | rabbit | AB_2120669 | Aviva Systems Biology | ARP40585_T100 | 2025-08-19 11:05:08 | 0 | ||
|
Anti-BNIP2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA026843, RRID:AB_1845403 | BNIP2 | rat, human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845403 | Atlas Antibodies | HPA026843 | 2025-08-19 11:05:08 | 0 | ||
|
Anti-KRT25 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA058943, RRID:AB_2683859 | KRT25 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2683859 | Atlas Antibodies | HPA058943 | 2025-08-19 11:05:36 | 0 | ||
|
Anti-B4GALNT1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA008968, RRID:AB_1078253 | B4GALNT1 antibody produced in rabbit | human | Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1078253 | Sigma-Aldrich | HPA008968 | 2025-08-19 11:05:47 | 0 | ||
|
ZFP36L1-human Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# WH0000677M2, RRID:AB_1844265 | ZFP36L1 | homo sapiens | Clone 1A3 | ENCODE PROJECT External validation DATA SET is released testing lot 07135-1A3 for not specified; status is not pursued | monoclonal | mouse | AB_1844265 | Sigma-Aldrich | WH0000677M2 | 2025-08-19 11:05:31 | 0 | |
|
Anti-SLC27A3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006935, RRID:AB_1080003 | SLC27A3 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1080003 | Atlas Antibodies | HPA006935 | 2025-08-19 10:58:20 | 0 | ||
|
Anti-EXOC7 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA022840, RRID:AB_1848316 | Human EXOC7 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1848316 | Sigma-Aldrich | HPA022840 | 2025-08-19 10:58:52 | 0 | ||
|
Anti-DGCR2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA000873, RRID:AB_1847632 | Human DGCR2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847632 | Sigma-Aldrich | HPA000873 | 2025-08-19 10:58:51 | 0 | ||
|
Anti-HLX antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA005968, RRID:AB_1079066 | Human HLX1 | human | Vendor recommendations: | unknown | rabbit | AB_1079066 | Sigma-Aldrich | HPA005968 | 2025-08-19 10:59:13 | 1 | ||
|
Phospho-FAK (Tyr397) (D20B1) Rabbit mAb Resource Report Resource Website 50+ mentions Rating or validation data |
Cell Signaling Technology Cat# 8556, RRID:AB_10891442 | Phospho-FAK (Tyr397) (D20B1) Rabbit mAb | rat, h, m, mouse, r, human, mk |
Applications: W, IP Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | rabbit | AB_10891442 | Cell Signaling Technology | 8556 | 2025-08-19 10:58:30 | 53 | ||
|
FOXM1-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX102170, RRID:AB_10720162 | FOXM1 | human | ENCODE PROJECT External validation DATA SET is released testing lot 40373 for K562,MCF-7,HEK293T; status is awaiting lab characterization,pending dcc review | polyclonal | rabbit | AB_10720162 | GeneTex | GTX102170 | 2025-08-19 10:59:02 | 0 | ||
|
Anti-Histone H3.3 Antibody, K27M mutant Resource Report Resource Website 10+ mentions Rating or validation data |
Millipore Cat# ABE419, RRID:AB_2728728 | Histone H3.3, K27M mutant | mouse, human |
for use in western blotting (WB) & Chromatin immunoprecipitation (ChIP). original provider is Merck Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
polyclonal | rabbit | AB_2728728 | Millipore | ABE419 | 2025-08-19 10:59:21 | 14 | ||
|
Anti-CCDC28A polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055125, RRID:AB_2682705 | CCDC28A | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682705 | Atlas Antibodies | HPA055125 | 2025-08-19 10:59:19 | 0 | ||
|
Anti-HRH4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA035009, RRID:AB_10671507 | HRH4 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQRE; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10671507 | Atlas Antibodies | HPA035009 | 2025-08-19 10:59:16 | 0 | ||
|
Anti-LMNTD1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA045911, RRID:AB_10962977 | LMNTD1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10962977 | Atlas Antibodies | HPA045911 | 2025-08-19 10:58:34 | 0 | ||
|
Anti-SERPINE3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055804, RRID:AB_2682928 | SERPINE3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682928 | Atlas Antibodies | HPA055804 | 2025-08-19 10:58:34 | 0 | ||
|
Anti-ICE1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA054452, RRID:AB_2682492 | ICE1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682492 | Atlas Antibodies | HPA054452 | 2025-08-19 10:58:34 | 0 | ||
|
Anti-ALDH9A1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA010873, RRID:AB_1078126 | ALDH9A1 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot | polyclonal | rabbit | AB_1078126 | Sigma-Aldrich | HPA010873 | 2025-08-19 10:59:35 | 0 | ||
|
Anti-THOC3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045071, RRID:AB_10959461 | THOC3 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10959461 | Sigma-Aldrich | HPA045071 | 2025-08-19 10:58:53 | 0 | |||
|
Anti-ABHD1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044390, RRID:AB_10959380 | ABHD1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10959380 | Sigma-Aldrich | HPA044390 | 2025-08-19 10:59:39 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
