Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 115 showing 2281 ~ 2300 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_155871

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_155871

Comments: Discontinued; Applications: IP (10-20 µg/mg lysate), WB (1:1,000-1:5,000)
Host Organism: goat
Clonality polyclonal
Target(s): ATM

Proper citation: Thermo Fisher Scientific Cat# A300-135A, RRID:AB_155871 Copy   


  • RRID:AB_2293429

    This resource has 10+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2293429

Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): EP300

Proper citation: Santa Cruz Biotechnology Cat# sc-584, RRID:AB_2293429 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10980026

Comments: Applications: ChIP (1:25), IP (1:100), WB (1:1,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): SMAD1

Proper citation: Thermo Fisher Scientific Cat# PA5-17122, RRID:AB_10980026 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1134243

Comments: Applications: FC, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): CD167a

Proper citation: BioLegend Cat# 334002, RRID:AB_1134243 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078898

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FMR1NB antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA011284, RRID:AB_1078898 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680890

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBP

Proper citation: Atlas Antibodies Cat# HPA049805, RRID:AB_2680890 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677721

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): IGIP

Proper citation: Atlas Antibodies Cat# HPA041877, RRID:AB_2677721 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679705

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPL18

Proper citation: Atlas Antibodies Cat# HPA046572, RRID:AB_2679705 Copy   


  • RRID:AB_2674844

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2674844

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): LEXM

Proper citation: Sigma-Aldrich Cat# HPA035889, RRID:AB_2674844 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686008

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SOCS3

Proper citation: Atlas Antibodies Cat# HPA068569, RRID:AB_2686008 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686767

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXB8

Proper citation: Atlas Antibodies Cat# HPA075905, RRID:AB_2686767 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685730

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HLRPKQKPKNSKHCRDAKFEGTRIPHLVKKRRYQKQDSENKSEAKEQSNDDYVLEKLFKKSVGVHSVMKHDAIMDGASPD; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): ERCC6

Proper citation: Atlas Antibodies Cat# HPA066830, RRID:AB_2685730 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685052

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AEBP1

Proper citation: Atlas Antibodies Cat# HPA063595, RRID:AB_2685052 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1856386

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human RNMTL1

Proper citation: Sigma-Aldrich Cat# HPA022534, RRID:AB_1856386 Copy   


  • RRID:AB_2138790

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2138790

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: goat
Clonality polyclonal
Target(s): LYZ

Proper citation: Santa Cruz Biotechnology Cat# sc-27958, RRID:AB_2138790 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_563556

Comments: Used By NYUIHC-1426
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Prokaryotic recombinant fusion protein corresponding to the extracellular region of the CD38 molecule.

Proper citation: Leica Biosystems Cat# NCL-CD38-290, RRID:AB_563556 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_370186

Comments: Applications: WB, ICC/IF, IP, IHC
Host Organism: mouse
Clonality monoclonal
Target(s): E2F1

Proper citation: GeneTex Cat# GTX70165, RRID:AB_370186 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2313552

Comments: Applications: ICC, IHC, WB
Host Organism: chicken
Clonality polyclonal
Target(s): Neurofilament Heavy Chain (NFH)

Proper citation: Antibodies Incorporated Cat# NFH, RRID:AB_2313552 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600818

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1429 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA031530, RRID:AB_10600818 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600196

Comments: Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SYTL3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA030584, RRID:AB_10600196 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X