Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
ATM Antibody Resource Report Resource Website Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A300-135A, RRID:AB_155871 | ATM | mouse, human | Discontinued; Applications: IP (10-20 µg/mg lysate), WB (1:1,000-1:5,000) | polyclonal | goat | AB_155871 | Thermo Fisher Scientific | A300-135A | 2025-08-20 03:52:57 | 0 | ||
|
EP300-human,EP300-mouse Resource Report Resource Website 10+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-584, RRID:AB_2293429 | EP300 | homo sapiens, mus musculus | N-15 | Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization | polyclonal | rabbit | AB_2293429 | Santa Cruz Biotechnology | sc-584 | 2025-08-20 03:52:54 | 18 | |
|
SMAD1 Polyclonal Antibody Resource Report Resource Website Rating or validation data |
Thermo Fisher Scientific Cat# PA5-17122, RRID:AB_10980026 | SMAD1 | Human, Mouse, Non-human primate | Applications: ChIP (1:25), IP (1:100), WB (1:1,000) | polyclonal | rabbit | AB_10980026 | Thermo Fisher Scientific | PA5-17122 (also ENCAB000AZS) | 2025-08-20 03:53:20 | 0 | ||
|
Purified anti-human CD167a (DDR1) Resource Report Resource Website Rating or validation data |
BioLegend Cat# 334002, RRID:AB_1134243 | CD167a | human | Clone 51D6 |
Applications: FC, IP Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_1134243 | BioLegend | 334002 | 2025-08-20 03:53:09 | 0 | |
|
Anti-FMR1NB antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA011284, RRID:AB_1078898 | FMR1NB antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1078898 | Sigma-Aldrich | HPA011284 | 2025-08-20 03:53:19 | 0 | ||
|
Anti-TBP polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA049805, RRID:AB_2680890 | TBP | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680890 | Atlas Antibodies | HPA049805 | 2025-08-20 03:40:55 | 0 | ||
|
Anti-IGIP polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA041877, RRID:AB_2677721 | IGIP | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2677721 | Atlas Antibodies | HPA041877 | 2025-08-20 03:41:20 | 0 | ||
|
Anti-RPL18 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA046572, RRID:AB_2679705 | RPL18 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679705 | Atlas Antibodies | HPA046572 | 2025-08-20 03:40:54 | 0 | ||
|
Anti-LEXM Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA035889, RRID:AB_2674844 | LEXM | human | unknown | rabbit | AB_2674844 | Sigma-Aldrich | HPA035889 | 2025-08-20 03:41:24 | 0 | |||
|
Anti-SOCS3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA068569, RRID:AB_2686008 | SOCS3 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686008 | Atlas Antibodies | HPA068569 | 2025-08-20 03:41:22 | 0 | ||
|
Anti-HOXB8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA075905, RRID:AB_2686767 | HOXB8 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686767 | Atlas Antibodies | HPA075905 | 2025-08-20 03:40:55 | 0 | ||
|
Anti-ERCC6 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA066830, RRID:AB_2685730 | ERCC6 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HLRPKQKPKNSKHCRDAKFEGTRIPHLVKKRRYQKQDSENKSEAKEQSNDDYVLEKLFKKSVGVHSVMKHDAIMDGASPD; Manufacturer approved use: ICC-IF | polyclonal | rabbit | AB_2685730 | Atlas Antibodies | HPA066830 | 2025-08-20 03:41:22 | 0 | ||
|
Anti-AEBP1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA063595, RRID:AB_2685052 | AEBP1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2685052 | Atlas Antibodies | HPA063595 | 2025-08-20 03:40:55 | 0 | ||
|
Anti-RNMTL1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA022534, RRID:AB_1856386 | Human RNMTL1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1856386 | Sigma-Aldrich | HPA022534 | 2025-08-20 03:41:56 | 0 | ||
|
Lysozyme C (C-19) Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-27958, RRID:AB_2138790 | LYZ | rat, mouse, human | C-19 |
Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
polyclonal | goat | AB_2138790 | Santa Cruz Biotechnology | sc-27958 | 2025-08-20 03:41:15 | 9 | |
|
CD 38, ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase Resource Report Resource Website Rating or validation data |
Leica Biosystems Cat# NCL-CD38-290, RRID:AB_563556 | Prokaryotic recombinant fusion protein corresponding to the extracellular region of the CD38 molecule. |
Used By NYUIHC-1426 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_563556 | Leica Biosystems | NCL-CD38-290 | 2025-08-20 03:41:38 | 0 | |||
|
E2F1 antibody [18E10] Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX70165, RRID:AB_370186 | E2F1 | human | Clone 18E10 | Applications: WB, ICC/IF, IP, IHC | monoclonal | mouse | AB_370186 | GeneTex | GTX70165 | 2025-08-20 03:41:36 | 0 | |
|
Anti-NFH (Neurofilament Heavy Chain) Antibody Resource Report Resource Website 10+ mentions Rating or validation data |
Antibodies Incorporated Cat# NFH, RRID:AB_2313552 | Neurofilament Heavy Chain (NFH) | rat, mouse, human | Applications: ICC, IHC, WB | polyclonal | chicken | AB_2313552 | Antibodies Incorporated | NFH | 2025-08-20 03:42:04 | 43 | ||
|
Anti-KIAA1429 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA031530, RRID:AB_10600818 | KIAA1429 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10600818 | Sigma-Aldrich | HPA031530 | 2025-08-20 03:42:09 | 0 | ||
|
Anti-SYTL3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA030584, RRID:AB_10600196 | SYTL3 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other | polyclonal | rabbit | AB_10600196 | Sigma-Aldrich | HPA030584 | 2025-08-20 03:42:09 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
