Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_155871
Comments: Discontinued; Applications: IP (10-20 µg/mg lysate), WB (1:1,000-1:5,000)
Host Organism: goat
Clonality polyclonal
Target(s): ATM
Proper citation: Thermo Fisher Scientific Cat# A300-135A, RRID:AB_155871 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2293429
Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): EP300
Proper citation: Santa Cruz Biotechnology Cat# sc-584, RRID:AB_2293429 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10980026
Comments: Applications: ChIP (1:25), IP (1:100), WB (1:1,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): SMAD1
Proper citation: Thermo Fisher Scientific Cat# PA5-17122, RRID:AB_10980026 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1134243
Comments: Applications: FC, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): CD167a
Proper citation: BioLegend Cat# 334002, RRID:AB_1134243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078898
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FMR1NB antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011284, RRID:AB_1078898 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680890
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBP
Proper citation: Atlas Antibodies Cat# HPA049805, RRID:AB_2680890 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677721
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): IGIP
Proper citation: Atlas Antibodies Cat# HPA041877, RRID:AB_2677721 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679705
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPL18
Proper citation: Atlas Antibodies Cat# HPA046572, RRID:AB_2679705 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674844
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): LEXM
Proper citation: Sigma-Aldrich Cat# HPA035889, RRID:AB_2674844 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686008
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SOCS3
Proper citation: Atlas Antibodies Cat# HPA068569, RRID:AB_2686008 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686767
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXB8
Proper citation: Atlas Antibodies Cat# HPA075905, RRID:AB_2686767 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685730
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HLRPKQKPKNSKHCRDAKFEGTRIPHLVKKRRYQKQDSENKSEAKEQSNDDYVLEKLFKKSVGVHSVMKHDAIMDGASPD; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): ERCC6
Proper citation: Atlas Antibodies Cat# HPA066830, RRID:AB_2685730 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685052
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AEBP1
Proper citation: Atlas Antibodies Cat# HPA063595, RRID:AB_2685052 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856386
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human RNMTL1
Proper citation: Sigma-Aldrich Cat# HPA022534, RRID:AB_1856386 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2138790
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: goat
Clonality polyclonal
Target(s): LYZ
Proper citation: Santa Cruz Biotechnology Cat# sc-27958, RRID:AB_2138790 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_563556
Comments: Used By NYUIHC-1426
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Prokaryotic recombinant fusion protein corresponding to the extracellular region of the CD38 molecule.
Proper citation: Leica Biosystems Cat# NCL-CD38-290, RRID:AB_563556 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_370186
Comments: Applications: WB, ICC/IF, IP, IHC
Host Organism: mouse
Clonality monoclonal
Target(s): E2F1
Proper citation: GeneTex Cat# GTX70165, RRID:AB_370186 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2313552
Comments: Applications: ICC, IHC, WB
Host Organism: chicken
Clonality polyclonal
Target(s): Neurofilament Heavy Chain (NFH)
Proper citation: Antibodies Incorporated Cat# NFH, RRID:AB_2313552 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600818
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1429 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031530, RRID:AB_10600818 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600196
Comments: Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SYTL3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030584, RRID:AB_10600196 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.