Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-SPACA5B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044747, RRID:AB_2679071 SPACA5B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679071 Atlas Antibodies HPA044747 2025-08-20 02:56:23 0
Anti-CBFB
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038852, RRID:AB_10795358 CBFB human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10795358 Atlas Antibodies HPA038852 2025-08-20 02:56:23 0
Anti-STOX1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037844, RRID:AB_2675700 STOX1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675700 Atlas Antibodies HPA037844 2025-08-20 02:56:23 0
Anti-ATG16L2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045444, RRID:AB_2679324 ATG16L2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679324 Atlas Antibodies HPA045444 2025-08-20 02:55:44 0
Anti-SLC6A13 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052726, RRID:AB_2681927 SLC6A13 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT; Manufacturer approved use: ICC-IF, IHC polyclonal rabbit AB_2681927 Atlas Antibodies HPA052726 2025-08-20 02:55:44 0
Anti-MAP1A
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA039063, RRID:AB_2676327 MAP1A human unknown rabbit AB_2676327 Sigma-Aldrich HPA039063 2025-08-20 02:56:24 0
Anti-IRF6
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA076162, RRID:AB_2686780 IRF6 human Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2686780 Atlas Antibodies HPA076162 2025-08-20 02:55:45 0
Anti-SOCS4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057961, RRID:AB_2683564 SOCS4 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683564 Atlas Antibodies HPA057961 2025-08-20 02:55:45 0
Anti-GEMIN5 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA037393, RRID:AB_10672489 GEMIN5 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10672489 Atlas Antibodies HPA037393 2025-08-20 02:55:44 1
Anti-CLRN2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042407, RRID:AB_10806237 CLRN2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10806237 Atlas Antibodies HPA042407 2025-08-20 02:55:44 0
Anti-IZUMO2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042195, RRID:AB_10794788 IZUMO2 antibody produced in rabbit human polyclonal rabbit AB_10794788 Atlas Antibodies HPA042195 2025-08-20 02:55:53 0
Anti-C22orf15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA018006, RRID:AB_1848902 C22orf15 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MFIKVMFGAGCSVLVNTSCRLVNLTAHLRQKAGLPPDATIALLAEDGNLVSLEEDLKEGASRAQTMGNSLL; Manufacturer approved use: IHC polyclonal rabbit AB_1848902 Atlas Antibodies HPA018006 2025-08-20 02:56:25 0
Anti-TLDC1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041020, RRID:AB_10794184 TLDC1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794184 Atlas Antibodies HPA041020 2025-08-20 02:35:45 0
Anti-UTP20 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049341, RRID:AB_2680720 UTP20 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680720 Atlas Antibodies HPA049341 2025-08-20 02:35:30 0
Anti-VWA5B1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064829, RRID:AB_2685363 VWA5B1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685363 Atlas Antibodies HPA064829 2025-08-20 02:35:46 0
Anti-U2SURP
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037546, RRID:AB_2675535 U2SURP human Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2675535 Atlas Antibodies HPA037546 2025-08-20 02:35:29 0
Anti-RNASEK polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044708, RRID:AB_10962051 RNASEK human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10962051 Atlas Antibodies HPA044708 2025-08-20 02:35:45 0
Anti-CST7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040442, RRID:AB_2676988 CST7 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676988 Atlas Antibodies HPA040442 2025-08-20 02:35:45 0
Anti-SLC6A7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028907, RRID:AB_10602404 SLC6A7 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602404 Atlas Antibodies HPA028907 2025-08-20 02:35:29 0
Anti-PHAX polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059630, RRID:AB_2684088 PHAX human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684088 Atlas Antibodies HPA059630 2025-08-20 02:35:31 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.