Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PEX11A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA039115, RRID:AB_10671870 PEX11A antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10671870 Sigma-Aldrich HPA039115 2025-08-19 10:56:44 0
Anti-IL1F8 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA035664, RRID:AB_10669672 IL1F8 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10669672 Sigma-Aldrich HPA035664 2025-08-19 10:56:44 0
FOXO1 antibody
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX110724, RRID:AB_10617375 FOXO1 xenopus, squirrel, human Applications: WB polyclonal rabbit AB_10617375 GeneTex GTX110724 2025-08-19 10:56:26 0
Anti-NIPBL antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA040834, RRID:AB_10796562 NIPBL antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10796562 Sigma-Aldrich HPA040834 2025-08-19 10:56:48 0
Anti-BRPF1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA003359, RRID:AB_1078217 Human ARPC4 human Vendor recommendations: unknown rabbit AB_1078217 Sigma-Aldrich HPA003359 2025-08-19 10:56:24 0
Anti-C6orf130 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA029036, RRID:AB_10602336 C6orf130 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10602336 Sigma-Aldrich HPA029036 2025-08-19 10:56:30 0
Anti-FDPS antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA028200, RRID:AB_10612109 FDPS antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other polyclonal rabbit AB_10612109 Sigma-Aldrich HPA028200 2025-08-19 10:56:54 0
Anti-PAX9 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA038462, RRID:AB_10672594 PAX9 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other polyclonal rabbit AB_10672594 Sigma-Aldrich HPA038462 2025-08-19 10:56:56 0
Anti-ADAMTS10 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA040223, RRID:AB_10795376 ADAMTS10 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_10795376 Sigma-Aldrich HPA040223 2025-08-19 10:56:41 0
REL-human
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Santa Cruz Biotechnology Cat# sc-71, RRID:AB_2253705 REL homo sapiens C Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot L1112 for not specified; status is not pursued polyclonal rabbit AB_2253705 Santa Cruz Biotechnology sc-71 2025-08-19 10:56:55 3
Anti-ZNF83 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA025970, RRID:AB_1859463 ZNF83 antibody produced in rabbit human Vendor recommendations: Western Blot; Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1859463 Sigma-Aldrich HPA025970 2025-08-19 10:57:07 0
Anti-SPTBN1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA012685, RRID:AB_1857433 SPTBN1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry polyclonal rabbit AB_1857433 Sigma-Aldrich HPA012685 2025-08-19 10:57:06 0
Anti-ASPHD1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA045175, RRID:AB_10959899 ASPHD1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10959899 Sigma-Aldrich HPA045175 2025-08-19 10:57:08 0
Anti-PRTN3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA005938, RRID:AB_1855764 PRTN3 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1855764 Sigma-Aldrich HPA005938 2025-08-19 10:57:05 0
Anti-MYO1G polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA021252, RRID:AB_1854254 MYO1G human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854254 Atlas Antibodies HPA021252 2025-08-19 11:03:24 0
Anti-IDO1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA023149, RRID:AB_1846221 IDO1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1846221 Atlas Antibodies HPA023149 2025-08-19 11:03:24 2
Anti-MPP3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024742, RRID:AB_1854087 MPP3 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1854087 Atlas Antibodies HPA024742 2025-08-19 11:03:25 0
Anti-CRISPLD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030055, RRID:AB_10611821 CRISPLD2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10611821 Atlas Antibodies HPA030055 2025-08-19 11:03:35 0
Anti-FMNL3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA023201, RRID:AB_1848575 FMNL3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1848575 Atlas Antibodies HPA023201 2025-08-19 11:03:35 0
Anti-KLF15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028866, RRID:AB_10600819 KLF15 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPG; Manufacturer approved use: IHC polyclonal rabbit AB_10600819 Atlas Antibodies HPA028866 2025-08-19 11:03:35 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.