Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601119
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSR; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): BARHL2
Proper citation: Atlas Antibodies Cat# HPA028176, RRID:AB_10601119 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667822
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACVR2B
Proper citation: Atlas Antibodies Cat# HPA007398, RRID:AB_2667822 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856745
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SGK3
Proper citation: Atlas Antibodies Cat# HPA027146, RRID:AB_1856745 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078455
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): GYPC
Proper citation: Atlas Antibodies Cat# HPA008965, RRID:AB_1078455 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681131
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): HSDL2
Proper citation: Sigma-Aldrich Cat# HPA050453, RRID:AB_2681131 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2092153
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): DHX33
Proper citation: Thermo Fisher Scientific Cat# A300-800A, RRID:AB_2092153 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670170
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): SULT1C4 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA034530, RRID:AB_10670170 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854738
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human NXT2
Proper citation: Sigma-Aldrich Cat# HPA024199, RRID:AB_1854738 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857726
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TACR2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012084, RRID:AB_1857726 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2274278
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ATG2B
Proper citation: Sigma-Aldrich Cat# HPA019665, RRID:AB_2274278 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_94052
Comments: seller recommendations: Immunohistochemistry; Immunoprecipitation; Immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Mitochondria
Proper citation: Millipore Cat# MAB1273, RRID:AB_94052 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672785
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BAP1
Proper citation: Atlas Antibodies Cat# HPA028815, RRID:AB_2672785 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11169036
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40618 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): EIF4A1
Proper citation: GeneTex Cat# GTX107319, RRID:AB_11169036 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335903
Comments: Used By NYUIHC-86
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: BD Biosciences Cat# C31720, RRID:AB_2335903 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683133
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CHMP5
Proper citation: Sigma-Aldrich Cat# HPA056437, RRID:AB_2683133 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680727
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VCX
Proper citation: Atlas Antibodies Cat# HPA049357, RRID:AB_2680727 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078479
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SELP
Proper citation: Atlas Antibodies Cat# HPA005990, RRID:AB_1078479 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794182
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACSBG2
Proper citation: Atlas Antibodies Cat# HPA043421, RRID:AB_10794182 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602822
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRRT3
Proper citation: Atlas Antibodies Cat# HPA035127, RRID:AB_10602822 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681415
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF816-ZNF321P
Proper citation: Atlas Antibodies Cat# HPA051271, RRID:AB_2681415 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
