Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616070
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 41101 for GM12878,HepG2,MCF-7,K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): NBN
Proper citation: GeneTex Cat# GTX103229, RRID:AB_2616070 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079533
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): OSTM1
Proper citation: Atlas Antibodies Cat# HPA010851, RRID:AB_1079533 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856635
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SCRG1
Proper citation: Atlas Antibodies Cat# HPA012882, RRID:AB_1856635 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599976
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): FRS3
Proper citation: Atlas Antibodies Cat# HPA030162, RRID:AB_10599976 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079557
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PAG1
Proper citation: Atlas Antibodies Cat# HPA001632, RRID:AB_1079557 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615116
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC11130-100401 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10567398, AB_2615116.
Host Organism: rabbit
Clonality unknown
Target(s): HNRNPUL1
Proper citation: Aviva Systems Biology Cat# ARP40701_P050, RRID:AB_2615116 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795287
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): BRCA1
Proper citation: Atlas Antibodies Cat# HPA034966, RRID:AB_10795287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674189
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PLEKHA3
Proper citation: Atlas Antibodies Cat# HPA034496, RRID:AB_2674189 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794652
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NOL10
Proper citation: Atlas Antibodies Cat# HPA043075, RRID:AB_10794652 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078681
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DLX5
Proper citation: Atlas Antibodies Cat# HPA005670, RRID:AB_1078681 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675963
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OSBPL5
Proper citation: Atlas Antibodies Cat# HPA038335, RRID:AB_2675963 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845475
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NACC1
Proper citation: Atlas Antibodies Cat# HPA021238, RRID:AB_1845475 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603682
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LAMP5
Proper citation: Atlas Antibodies Cat# HPA004802, RRID:AB_10603682 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680470
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TMC4
Proper citation: Atlas Antibodies Cat# HPA048635, RRID:AB_2680470 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678474
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): UMOD
Proper citation: Atlas Antibodies Cat# HPA043420, RRID:AB_2678474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855178
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): PECR antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA022539, RRID:AB_1855178 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849458
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): GALNTL2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017076, RRID:AB_1849458 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602926
Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PPP6R2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030656, RRID:AB_10602926 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10619417
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40268 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): NXF2
Proper citation: GeneTex Cat# GTX116623, RRID:AB_10619417 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601987
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): MMACHC antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027399, RRID:AB_10601987 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.