Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
NBN-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX103229, RRID:AB_2616070 | NBN | human | ENCODE PROJECT External validation DATA SET is released testing lot 41101 for GM12878,HepG2,MCF-7,K562; status is awaiting lab characterization | polyclonal | rabbit | AB_2616070 | GeneTex | GTX103229 (also ENCAB543ANT) | 2025-08-20 02:59:56 | 0 | ||
|
Anti-OSTM1 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA010851, RRID:AB_1079533 | OSTM1 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1079533 | Atlas Antibodies | HPA010851 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-SCRG1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012882, RRID:AB_1856635 | SCRG1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1856635 | Atlas Antibodies | HPA012882 | 2025-08-20 02:59:57 | 0 | ||
|
Anti-FRS3 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA030162, RRID:AB_10599976 | FRS3 | human | Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10599976 | Atlas Antibodies | HPA030162 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-PAG1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA001632, RRID:AB_1079557 | PAG1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1079557 | Atlas Antibodies | HPA001632 | 2025-08-20 03:00:00 | 0 | ||
|
HNRNPUL1-human Resource Report Resource Website Rating or validation data |
Aviva Systems Biology Cat# ARP40701_P050, RRID:AB_2615116 | HNRNPUL1 | Homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot QC11130-100401 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10567398, AB_2615116. | unknown | rabbit | AB_2615116 | Aviva Systems Biology | ARP40701_P050 (also ENCAB000AWG) | 2025-08-20 02:59:57 | 0 | ||
|
Anti-BRCA1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA034966, RRID:AB_10795287 | BRCA1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10795287 | Atlas Antibodies | HPA034966 | 2025-08-20 02:59:57 | 0 | ||
|
Anti-PLEKHA3 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA034496, RRID:AB_2674189 | PLEKHA3 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2674189 | Atlas Antibodies | HPA034496 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-NOL10 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA043075, RRID:AB_10794652 | NOL10 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10794652 | Atlas Antibodies | HPA043075 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-DLX5 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA005670, RRID:AB_1078681 | DLX5 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1078681 | Atlas Antibodies | HPA005670 | 2025-08-20 03:00:00 | 4 | ||
|
Anti-OSBPL5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038335, RRID:AB_2675963 | OSBPL5 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2675963 | Atlas Antibodies | HPA038335 | 2025-08-20 02:59:57 | 0 | ||
|
Anti-NACC1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021238, RRID:AB_1845475 | NACC1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845475 | Atlas Antibodies | HPA021238 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-LAMP5 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA004802, RRID:AB_10603682 | LAMP5 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10603682 | Atlas Antibodies | HPA004802 | 2025-08-20 02:59:57 | 0 | ||
|
Anti-TMC4 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048635, RRID:AB_2680470 | TMC4 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2680470 | Atlas Antibodies | HPA048635 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-UMOD Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA043420, RRID:AB_2678474 | UMOD | human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2678474 | Atlas Antibodies | HPA043420 | 2025-08-20 03:00:01 | 0 | ||
|
Anti-PECR antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA022539, RRID:AB_1855178 | PECR antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_1855178 | Sigma-Aldrich | HPA022539 | 2025-08-20 03:00:03 | 0 | ||
|
Anti-GALNTL2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA017076, RRID:AB_1849458 | GALNTL2 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot | polyclonal | rabbit | AB_1849458 | Sigma-Aldrich | HPA017076 | 2025-08-20 03:00:18 | 0 | ||
|
Anti-PPP6R2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA030656, RRID:AB_10602926 | PPP6R2 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10602926 | Sigma-Aldrich | HPA030656 | 2025-08-20 03:00:05 | 0 | ||
|
NXF2-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX116623, RRID:AB_10619417 | NXF2 | human | ENCODE PROJECT External validation DATA SET is released testing lot 40268 for not specified; status is not pursued | polyclonal | rabbit | AB_10619417 | GeneTex | GTX116623 | 2025-08-20 03:00:06 | 0 | ||
|
Anti-MMACHC antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA027399, RRID:AB_10601987 | MMACHC antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10601987 | Sigma-Aldrich | HPA027399 | 2025-08-20 03:00:25 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
