Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615878
Comments: manufacturer recommendations: IgG WB(1:100-500), ELISA(1:500-1000), IP(1:20-100), IHC-P(1:100-500), IHC-F(1:100-500), Flow-Cyt(1:20-100), IF(1:50-200); Western Blot; ELISA; Flow Cytometry; Immunohistochemistry; Immunoprecipitation; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10855094, AB_2615878.
Host Organism: rabbit
Clonality polyclonal
Target(s): Rabbit HDAC11
Proper citation: Bioss Cat# bs-2894R, RRID:AB_2615878 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_564153
Comments: Used By NYUIHC-571
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism:
Clonality monoclonal
Target(s): Prokaryotic recombinant fusion protein corresponding to th ec-terminus of the TRP-1 molecule
Proper citation: Leica Biosystems Cat# NCL-TRP-1, RRID:AB_564153 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1576598
Comments: Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): Tat-SF1
Proper citation: Thermo Fisher Scientific Cat# A302-023A, RRID:AB_1576598 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681866
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CYB561A3
Proper citation: Sigma-Aldrich Cat# HPA052548, RRID:AB_2681866 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079729
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): RAB25
Proper citation: Atlas Antibodies Cat# HPA010872, RRID:AB_1079729 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_937890
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): GTF2IRD/TFII-IRD1
Proper citation: Bethyl Cat# A301-333A, RRID:AB_937890 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_242522
Comments: Applications: WB, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ADNP
Proper citation: Bethyl Cat# A300-104A, RRID:AB_242522 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673534
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTR; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP12A
Proper citation: Atlas Antibodies Cat# HPA039526, RRID:AB_10673534 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683335
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AP5M1
Proper citation: Atlas Antibodies Cat# HPA057098, RRID:AB_2683335 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683232
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): SFTPD
Proper citation: Sigma-Aldrich Cat# HPA056768, RRID:AB_2683232 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681402
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PCDH12
Proper citation: Atlas Antibodies Cat# HPA051242, RRID:AB_2681402 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601665
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATAD2B
Proper citation: Atlas Antibodies Cat# HPA034555, RRID:AB_10601665 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672242
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): FAM207A
Proper citation: Atlas Antibodies Cat# HPA036354, RRID:AB_10672242 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079697
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRSS21
Proper citation: Atlas Antibodies Cat# HPA008477, RRID:AB_1079697 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683282
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC142
Proper citation: Atlas Antibodies Cat# HPA056946, RRID:AB_2683282 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677947
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ABCC8
Proper citation: Atlas Antibodies Cat# HPA042318, RRID:AB_2677947 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686741
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HEBP1
Proper citation: Atlas Antibodies Cat# HPA075277, RRID:AB_2686741 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678482
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NFE2L2
Proper citation: Atlas Antibodies Cat# HPA043438, RRID:AB_2678482 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078693
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DNAJB7
Proper citation: Atlas Antibodies Cat# HPA000534, RRID:AB_1078693 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079413
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MRVI1
Proper citation: Atlas Antibodies Cat# HPA008704, RRID:AB_1079413 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.