Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079400
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MNAT1
Proper citation: Atlas Antibodies Cat# HPA000701, RRID:AB_1079400 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857751
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TAF7L
Proper citation: Atlas Antibodies Cat# HPA001879, RRID:AB_1857751 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673916
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POLR1A
Proper citation: Atlas Antibodies Cat# HPA031513, RRID:AB_2673916 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962626
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ANKRD46
Proper citation: Atlas Antibodies Cat# HPA013758, RRID:AB_10962626 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080751
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF75A
Proper citation: Atlas Antibodies Cat# HPA001665, RRID:AB_1080751 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855255
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQKRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCDVALHVKCSVEY; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): PGBD3
Proper citation: Atlas Antibodies Cat# HPA025825, RRID:AB_1855255 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846164
Comments: Vendor recommendations: Western Blot; Other; Immunofluorescence; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019051, RRID:AB_1846164 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1953051
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is eligible for new data
Host Organism: rabbit
Clonality unknown
Target(s): PCBP1
Proper citation: MBL International Cat# RN024P, RRID:AB_1953051 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852924
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): STK11 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017254, RRID:AB_1852924 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670933
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): C6orf186 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037441, RRID:AB_10670933 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672288
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ANAPC16 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037815, RRID:AB_10672288 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669655
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OFD1
Proper citation: Atlas Antibodies Cat# HPA031104, RRID:AB_10669655 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848833
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NARS2
Proper citation: Atlas Antibodies Cat# HPA026793, RRID:AB_1848833 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961859
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC38A9
Proper citation: Atlas Antibodies Cat# HPA043785, RRID:AB_10961859 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670150
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ABP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031032, RRID:AB_10670150 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2204758
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM150A
Proper citation: Atlas Antibodies Cat# HPA019015, RRID:AB_2204758 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795694
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RERGL
Proper citation: Atlas Antibodies Cat# HPA041740, RRID:AB_10795694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852607
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KLK7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018994, RRID:AB_1852607 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10548197
Comments: Applications: W, IF-IC, F. Consolidation on 10/2018: AB_10548197, AB_10828695.
Host Organism: rabbit
Clonality monoclonal
Target(s): DNMT1 (D63A6) XP Rabbit mAb
Proper citation: Cell Signaling Technology Cat# 5032, RRID:AB_10548197 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844979
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ARFGAP2
Proper citation: Sigma-Aldrich Cat# HPA018152, RRID:AB_1844979 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
