Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686734
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCF; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): OTUB2
Proper citation: Atlas Antibodies Cat# HPA075090, RRID:AB_2686734 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672772
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP4A
Proper citation: Atlas Antibodies Cat# HPA039154, RRID:AB_10672772 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684500
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TACC2
Proper citation: Atlas Antibodies Cat# HPA061394, RRID:AB_2684500 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683541
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NKPFKFMLGKQEVIRGWEEG; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): FKBP1A
Proper citation: Atlas Antibodies Cat# HPA057830, RRID:AB_2683541 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676740
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CCDC84
Proper citation: Sigma-Aldrich Cat# HPA039906, RRID:AB_2676740 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674370
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KRT4
Proper citation: Atlas Antibodies Cat# HPA034881, RRID:AB_2674370 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611381
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LAP3
Proper citation: Atlas Antibodies Cat# HPA029607, RRID:AB_10611381 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848147
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): EMP2
Proper citation: Atlas Antibodies Cat# HPA014711, RRID:AB_1848147 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602287
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NUP43
Proper citation: Atlas Antibodies Cat# HPA028500, RRID:AB_10602287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078721
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EFNB2
Proper citation: Atlas Antibodies Cat# HPA008999, RRID:AB_1078721 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683503
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ADRA2C
Proper citation: Atlas Antibodies Cat# HPA057688, RRID:AB_2683503 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_518147
Comments: Applications: Immunohistochemistry, Immunocytochemistry
Consolidation on 9/2020: AB_518147, AB_2307330, AB_2313775.
Host Organism: rabbit
Clonality monoclonal
Target(s): alpha-CGRP
Proper citation: Peninsula Laboratories Cat# T-4032, RRID:AB_518147 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611254
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): KIF2B
Proper citation: Atlas Antibodies Cat# HPA023103, RRID:AB_10611254 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079381
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MITF
Proper citation: Atlas Antibodies Cat# HPA003259, RRID:AB_1079381 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616098
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 2C3 for any cell type or tissues; status is awaiting lab characterization
Host Organism: mouse
Clonality unknown
Target(s): H3K36me3
Proper citation: Hiroshi Kimura Cat# HK00012, RRID:AB_2616098 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079356
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MEIS2
Proper citation: Atlas Antibodies Cat# HPA003256, RRID:AB_1079356 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669882
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LAPTM4A
Proper citation: Atlas Antibodies Cat# HPA031402, RRID:AB_10669882 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078228
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NCOA6
Proper citation: Atlas Antibodies Cat# HPA004198, RRID:AB_1078228 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1040022
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF318/TZF
Proper citation: Bethyl Cat# A301-546A, RRID:AB_1040022 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616453
Comments: ENCODE PROJECT External validation DATA SET is released testing lot R72857 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): NR1D2
Proper citation: Sigma-Aldrich Cat# HPA054798, RRID:AB_2616453 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.