Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 151 showing 3001 ~ 3020 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1853578

Comments: Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): MARCH4 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA014348, RRID:AB_1853578 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600767

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM135A antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA031743, RRID:AB_10600767 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854459

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): TRAPPC9

Proper citation: Atlas Antibodies Cat# HPA026579, RRID:AB_1854459 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2294503

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GALNT8

Proper citation: Atlas Antibodies Cat# HPA012638, RRID:AB_2294503 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2338619

Comments: Originating manufacturer of this product
Host Organism:
Clonality unknown
Target(s): Mouse IgG (subclasses1+2a+2b+3), Fc? Fragment Specific

Proper citation: Jackson ImmunoResearch Labs Cat# 115-115-164, RRID:AB_2338619 Copy   


  • RRID:AB_1846664

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846664

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CHKA

Proper citation: Atlas Antibodies Cat# HPA024153, RRID:AB_1846664 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848573

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FHOD3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA024696, RRID:AB_1848573 Copy   


  • RRID:AB_10649508

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10649508

Comments: ENCODE PROJECT External validation DATA SET is released testing lot F0811 for not specified; status is not pursued
Host Organism: mouse
Clonality monoclonal
Target(s): STAT5A

Proper citation: Santa Cruz Biotechnology Cat# sc-271542, RRID:AB_10649508 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2666143

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HNRNPH2

Proper citation: Atlas Antibodies Cat# HPA000914, RRID:AB_2666143 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2667655

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RAD18

Proper citation: Atlas Antibodies Cat# HPA006724, RRID:AB_2667655 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675541

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSP; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): FANK1

Proper citation: Atlas Antibodies Cat# HPA037557, RRID:AB_2675541 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1215871

Comments: manufacturer recommendations: IgG ELISA; Western Blot; WB; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615125, AB_1215871.
Host Organism: rabbit
Clonality polyclonal
Target(s): HNRPM (against the N terminal of HNRPM) (50ug)

Proper citation: Aviva Systems Biology Cat# ARP40620_P050, RRID:AB_1215871 Copy   


  • RRID:AB_1848014

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848014

Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NECAB1

Proper citation: Atlas Antibodies Cat# HPA023629, RRID:AB_1848014 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794636

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): RPGRIP1L antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA039405, RRID:AB_10794636 Copy   


  • RRID:AB_10858998

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10858998

Comments: Used By NYUIHC-1089
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism:
Clonality monoclonal
Target(s): Porcine Pyruvate Dehydrogenase E2 protein.

Proper citation: Abcam Cat# ab110332, RRID:AB_10858998 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2564934

Comments: Applications: WB, IHC, ICC, ELISA
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: Rat
Clonality monoclonal
Target(s): TDP43 Phospho Ser409/410

Proper citation: BioLegend Cat# 829901, RRID:AB_2564934 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10959604

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): WDR78 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045793, RRID:AB_10959604 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794030

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): COG6 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA040441, RRID:AB_10794030 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854057

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human MOGAT3

Proper citation: Sigma-Aldrich Cat# HPA011940, RRID:AB_1854057 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679686

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR33

Proper citation: Atlas Antibodies Cat# HPA046527, RRID:AB_2679686 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X