Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853578
Comments: Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): MARCH4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA014348, RRID:AB_1853578 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600767
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM135A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031743, RRID:AB_10600767 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854459
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): TRAPPC9
Proper citation: Atlas Antibodies Cat# HPA026579, RRID:AB_1854459 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2294503
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GALNT8
Proper citation: Atlas Antibodies Cat# HPA012638, RRID:AB_2294503 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2338619
Comments: Originating manufacturer of this product
Host Organism:
Clonality unknown
Target(s): Mouse IgG (subclasses1+2a+2b+3), Fc? Fragment Specific
Proper citation: Jackson ImmunoResearch Labs Cat# 115-115-164, RRID:AB_2338619 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846664
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CHKA
Proper citation: Atlas Antibodies Cat# HPA024153, RRID:AB_1846664 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848573
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FHOD3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024696, RRID:AB_1848573 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10649508
Comments: ENCODE PROJECT External validation DATA SET is released testing lot F0811 for not specified; status is not pursued
Host Organism: mouse
Clonality monoclonal
Target(s): STAT5A
Proper citation: Santa Cruz Biotechnology Cat# sc-271542, RRID:AB_10649508 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666143
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HNRNPH2
Proper citation: Atlas Antibodies Cat# HPA000914, RRID:AB_2666143 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667655
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RAD18
Proper citation: Atlas Antibodies Cat# HPA006724, RRID:AB_2667655 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675541
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSP; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): FANK1
Proper citation: Atlas Antibodies Cat# HPA037557, RRID:AB_2675541 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1215871
Comments: manufacturer recommendations: IgG ELISA; Western Blot; WB; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615125, AB_1215871.
Host Organism: rabbit
Clonality polyclonal
Target(s): HNRPM (against the N terminal of HNRPM) (50ug)
Proper citation: Aviva Systems Biology Cat# ARP40620_P050, RRID:AB_1215871 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848014
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NECAB1
Proper citation: Atlas Antibodies Cat# HPA023629, RRID:AB_1848014 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794636
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): RPGRIP1L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA039405, RRID:AB_10794636 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10858998
Comments: Used By NYUIHC-1089
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism:
Clonality monoclonal
Target(s): Porcine Pyruvate Dehydrogenase E2 protein.
Proper citation: Abcam Cat# ab110332, RRID:AB_10858998 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2564934
Comments: Applications: WB, IHC, ICC, ELISA
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: Rat
Clonality monoclonal
Target(s): TDP43 Phospho Ser409/410
Proper citation: BioLegend Cat# 829901, RRID:AB_2564934 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959604
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): WDR78 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045793, RRID:AB_10959604 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794030
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): COG6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040441, RRID:AB_10794030 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854057
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human MOGAT3
Proper citation: Sigma-Aldrich Cat# HPA011940, RRID:AB_1854057 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679686
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR33
Proper citation: Atlas Antibodies Cat# HPA046527, RRID:AB_2679686 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.