Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964782
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C19orf57
Proper citation: Atlas Antibodies Cat# HPA044012, RRID:AB_10964782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600920
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRAPPC12
Proper citation: Atlas Antibodies Cat# HPA034799, RRID:AB_10600920 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680274
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LLGNLLQMDRRGLLKSFLRFREKYGDVFTVHL; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): CYP2B6
Proper citation: Atlas Antibodies Cat# HPA048124, RRID:AB_2680274 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601245
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PIP4K2C
Proper citation: Atlas Antibodies Cat# HPA028658, RRID:AB_10601245 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732695
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HSFX2
Proper citation: Atlas Antibodies Cat# HPA063040, RRID:AB_2732695 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844820
Comments: Vendor recommendations: Western Blot; Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ANGPT1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018793, RRID:AB_1844820 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858083
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM126B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA014480, RRID:AB_1858083 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852717
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): LASS2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027262, RRID:AB_1852717 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1587251
Comments: seller recommendations: Western Blot; Western Blotting
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): Smad2, phospho (Ser465 / Ser467)
Proper citation: Millipore Cat# 04-953, RRID:AB_1587251 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601363
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): DENND3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026100, RRID:AB_10601363 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080679
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ZNF174
Proper citation: Atlas Antibodies Cat# HPA009656, RRID:AB_1080679 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10805600
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): TIGD3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040016, RRID:AB_10805600 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080204
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human TAOK2
Proper citation: Sigma-Aldrich Cat# HPA010650, RRID:AB_1080204 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2260778
Comments: Used By NYUIHC-537
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Human (cartilage specific) CNBr-cleaved Collagen II
Proper citation: Millipore Cat# MAB1330, RRID:AB_2260778 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685186
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXD13
Proper citation: Atlas Antibodies Cat# HPA064064, RRID:AB_2685186 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672731
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): IFT46 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037909, RRID:AB_10672731 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078437
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human IL1RN
Proper citation: Sigma-Aldrich Cat# HPA001482, RRID:AB_1078437 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852963
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human LMO7
Proper citation: Sigma-Aldrich Cat# HPA020923, RRID:AB_1852963 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844682
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human AK5
Proper citation: Sigma-Aldrich Cat# HPA019128, RRID:AB_1844682 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2130216
Comments: validation status unknown, seller recommendations provided in 2012:western blot, immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): KLF4
Proper citation: Abcam Cat# ab26648, RRID:AB_2130216 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.