Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 156 showing 3101 ~ 3120 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964782

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C19orf57

Proper citation: Atlas Antibodies Cat# HPA044012, RRID:AB_10964782 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600920

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRAPPC12

Proper citation: Atlas Antibodies Cat# HPA034799, RRID:AB_10600920 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680274

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LLGNLLQMDRRGLLKSFLRFREKYGDVFTVHL; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): CYP2B6

Proper citation: Atlas Antibodies Cat# HPA048124, RRID:AB_2680274 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601245

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PIP4K2C

Proper citation: Atlas Antibodies Cat# HPA028658, RRID:AB_10601245 Copy   


  • RRID:AB_2732695

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2732695

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HSFX2

Proper citation: Atlas Antibodies Cat# HPA063040, RRID:AB_2732695 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844820

Comments: Vendor recommendations: Western Blot; Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ANGPT1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA018793, RRID:AB_1844820 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858083

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM126B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA014480, RRID:AB_1858083 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852717

Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): LASS2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA027262, RRID:AB_1852717 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1587251

Comments: seller recommendations: Western Blot; Western Blotting
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): Smad2, phospho (Ser465 / Ser467)

Proper citation: Millipore Cat# 04-953, RRID:AB_1587251 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601363

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): DENND3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA026100, RRID:AB_10601363 Copy   


  • RRID:AB_1080679

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080679

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ZNF174

Proper citation: Atlas Antibodies Cat# HPA009656, RRID:AB_1080679 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10805600

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): TIGD3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA040016, RRID:AB_10805600 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080204

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human TAOK2

Proper citation: Sigma-Aldrich Cat# HPA010650, RRID:AB_1080204 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2260778

Comments: Used By NYUIHC-537
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Human (cartilage specific) CNBr-cleaved Collagen II

Proper citation: Millipore Cat# MAB1330, RRID:AB_2260778 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685186

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXD13

Proper citation: Atlas Antibodies Cat# HPA064064, RRID:AB_2685186 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672731

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): IFT46 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA037909, RRID:AB_10672731 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078437

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human IL1RN

Proper citation: Sigma-Aldrich Cat# HPA001482, RRID:AB_1078437 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852963

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human LMO7

Proper citation: Sigma-Aldrich Cat# HPA020923, RRID:AB_1852963 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844682

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human AK5

Proper citation: Sigma-Aldrich Cat# HPA019128, RRID:AB_1844682 Copy   


  • RRID:AB_2130216

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2130216

Comments: validation status unknown, seller recommendations provided in 2012:western blot, immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): KLF4

Proper citation: Abcam Cat# ab26648, RRID:AB_2130216 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X