Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-C19orf57 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044012, RRID:AB_10964782 C19orf57 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10964782 Atlas Antibodies HPA044012 2025-08-20 04:06:22 0
Anti-TRAPPC12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA034799, RRID:AB_10600920 TRAPPC12 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600920 Atlas Antibodies HPA034799 2025-08-20 04:06:41 0
Anti-CYP2B6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048124, RRID:AB_2680274 CYP2B6 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LLGNLLQMDRRGLLKSFLRFREKYGDVFTVHL; Manufacturer approved use: IHC polyclonal rabbit AB_2680274 Atlas Antibodies HPA048124 2025-08-20 04:06:41 0
Anti-PIP4K2C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028658, RRID:AB_10601245 PIP4K2C human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601245 Atlas Antibodies HPA028658 2025-08-20 04:06:22 0
Anti-HSFX2 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA063040, RRID:AB_2732695 HSFX2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732695 Atlas Antibodies HPA063040 2025-08-20 04:06:23 0
Anti-ANGPT1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA018793, RRID:AB_1844820 ANGPT1 antibody produced in rabbit human Vendor recommendations: Western Blot; Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1844820 Sigma-Aldrich HPA018793 2025-08-20 04:11:25 0
Anti-TMEM126B antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA014480, RRID:AB_1858083 TMEM126B antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1858083 Sigma-Aldrich HPA014480 2025-08-20 04:11:29 1
Anti-LASS2 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA027262, RRID:AB_1852717 LASS2 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1852717 Sigma-Aldrich HPA027262 2025-08-20 04:12:08 1
Rabbit Anti-Smad2, phospho (Ser465 / Ser467) Monoclonal antibody, Unconjugated, Clone a5s
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Millipore Cat# 04-953, RRID:AB_1587251 Smad2, phospho (Ser465 / Ser467) canine, mouse, fish, zebrafish, human Clone A5S seller recommendations: Western Blot; Western Blotting
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal rabbit AB_1587251 Millipore 04-953 2025-08-20 04:12:11 2
Anti-DENND3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA026100, RRID:AB_10601363 DENND3 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601363 Sigma-Aldrich HPA026100 2025-08-20 04:11:38 0
Anti-ZNF174
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA009656, RRID:AB_1080679 ZNF174 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1080679 Atlas Antibodies HPA009656 2025-08-20 04:11:46 0
Anti-TIGD3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA040016, RRID:AB_10805600 TIGD3 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_10805600 Sigma-Aldrich HPA040016 2025-08-20 04:12:15 0
Anti-TAOK2 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA010650, RRID:AB_1080204 Human TAOK2 human Vendor recommendations: unknown rabbit AB_1080204 Sigma-Aldrich HPA010650 2025-08-20 04:11:49 1
Anti-Collagen Type II, clone COLL-II
 
Resource Report
Resource Website
Rating or validation data
Millipore Cat# MAB1330, RRID:AB_2260778 Human (cartilage specific) CNBr-cleaved Collagen II rat, mouse, human Used By NYUIHC-537
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2260778 Millipore MAB1330 2025-08-20 04:11:52 0
Anti-HOXD13 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064064, RRID:AB_2685186 HOXD13 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685186 Atlas Antibodies HPA064064 2025-08-20 04:11:50 0
Anti-IFT46 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA037909, RRID:AB_10672731 IFT46 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_10672731 Sigma-Aldrich HPA037909 2025-08-20 04:11:50 0
Anti-IL1RN antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA001482, RRID:AB_1078437 Human IL1RN human Vendor recommendations: unknown rabbit AB_1078437 Sigma-Aldrich HPA001482 2025-08-20 04:12:00 0
Anti-LMO7 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA020923, RRID:AB_1852963 Human LMO7 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1852963 Sigma-Aldrich HPA020923 2025-08-20 04:12:15 1
Anti-AK5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA019128, RRID:AB_1844682 Human AK5 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1844682 Sigma-Aldrich HPA019128 2025-08-20 04:12:13 0
KLF4 antibody
 
Resource Report
Resource Website
Rating or validation data
Abcam Cat# ab26648, RRID:AB_2130216 KLF4 human validation status unknown, seller recommendations provided in 2012:western blot, immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
polyclonal rabbit AB_2130216 Abcam ab26648 2025-08-20 04:12:07 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.