Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678996
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NPY
Proper citation: (Atlas Antibodies Cat# HPA044572, RRID:AB_2678996) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962723
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SLC25A16
Proper citation: (Atlas Antibodies Cat# HPA044580, RRID:AB_10962723) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10966138
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MEIG1
Proper citation: (Atlas Antibodies Cat# HPA044594, RRID:AB_10966138) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961423
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM258
Proper citation: (Atlas Antibodies Cat# HPA044602, RRID:AB_10961423) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795169
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GOLPH3
Proper citation: (Atlas Antibodies Cat# HPA044564, RRID:AB_10795169) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794501
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXB1
Proper citation: (Atlas Antibodies Cat# HPA044576, RRID:AB_10794501) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965785
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KAT7
Proper citation: (Atlas Antibodies Cat# HPA044470, RRID:AB_10965785) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794051
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HPSE2
Proper citation: (Atlas Antibodies Cat# HPA044603, RRID:AB_10794051) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965059
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CERS6
Proper citation: (Atlas Antibodies Cat# HPA044683, RRID:AB_10965059) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679033
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VCX2
Proper citation: (Atlas Antibodies Cat# HPA044642, RRID:AB_2679033) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679013
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SRA1
Proper citation: (Atlas Antibodies Cat# HPA044598, RRID:AB_2679013) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962867
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ETNPPL
Proper citation: (Atlas Antibodies Cat# HPA044546, RRID:AB_10962867) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10967265
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GAB4
Proper citation: (Atlas Antibodies Cat# HPA044621, RRID:AB_10967265) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962510
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): GALR2
Proper citation: (Atlas Antibodies Cat# HPA044513, RRID:AB_10962510) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795884
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NABP2
Proper citation: (Atlas Antibodies Cat# HPA044615, RRID:AB_10795884) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964630
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF717
Proper citation: (Atlas Antibodies Cat# HPA044549, RRID:AB_10964630) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960261
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACSM6
Proper citation: (Atlas Antibodies Cat# HPA044593, RRID:AB_10960261) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678975
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TNLNPSTCPSRPSVQSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPTSPDTNKAESSGKWNGLHTPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAVQ; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): REV1
Proper citation: (Atlas Antibodies Cat# HPA044534, RRID:AB_2678975) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796800
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LRIF1
Proper citation: (Atlas Antibodies Cat# HPA044515, RRID:AB_10796800) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794052
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C15orf62
Proper citation: (Atlas Antibodies Cat# HPA044636, RRID:AB_10794052) Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.