Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680616
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SAMD1
Proper citation: Atlas Antibodies Cat# HPA049059, RRID:AB_2680616 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672333
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MOCS3
Proper citation: Atlas Antibodies Cat# HPA027556, RRID:AB_2672333 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795028
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): OLAH antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037947, RRID:AB_10795028 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078604
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human CCNB2
Proper citation: Sigma-Aldrich Cat# HPA008873, RRID:AB_1078604 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678747
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CD3E
Proper citation: Atlas Antibodies Cat# HPA043955, RRID:AB_2678747 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794431
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TLX2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040969, RRID:AB_10794431 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079846
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human RPS21
Proper citation: Sigma-Aldrich Cat# HPA003371, RRID:AB_1079846 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1574973
Comments: Applications: FC
Host Organism: rat
Clonality monoclonal
Target(s): CD16/32
Proper citation: BioLegend Cat# 101319, RRID:AB_1574973 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_203172
Comments: manufacturer recommendations: CXCR4 antibody can be used for Western blot at 1 - 2 ug/mL dilution and for immunoprecipitation and immunocytochemistry at 10 & 956;g/mL. E, WB, ICC, IP; ELISA; Immunoprecipitation; Immunocytochemistry; Western Blot
Host Organism: rabbit
Clonality unknown
Target(s): CXCR4
Proper citation: ProSci Cat# 1009, RRID:AB_203172 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961276
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): METTL19 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045461, RRID:AB_10961276 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964727
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): CLCN7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043019, RRID:AB_10964727 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962508
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): GDF6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045206, RRID:AB_10962508 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964890
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): ATPBD4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042976, RRID:AB_10964890 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10967726
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): FAM186A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA047128, RRID:AB_10967726 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080383
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIM42
Proper citation: Atlas Antibodies Cat# HPA003581, RRID:AB_1080383 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601137
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): MUL1 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA026827, RRID:AB_10601137 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_309887
Comments: Applications: FC, ICC, IHC, IH(P), WB
Used By NYUIHC-1049
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Active-beta-Catenin
Proper citation: Millipore Cat# 05-665, RRID:AB_309887 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683719
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIII; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): CDH8
Proper citation: Atlas Antibodies Cat# HPA058444, RRID:AB_2683719 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732795
Comments: Applications: W
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): cGAS
Proper citation: Cell Signaling Technology Cat# 15102, RRID:AB_2732795 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859471
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF90
Proper citation: Atlas Antibodies Cat# HPA003227, RRID:AB_1859471 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
