Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845824
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CARNMT1
Proper citation: Atlas Antibodies Cat# HPA026756, RRID:AB_1845824 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672467
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): MAP9 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037864, RRID:AB_10672467 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852654
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KCNIP4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA022862, RRID:AB_1852654 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603346
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TC2N
Proper citation: Atlas Antibodies Cat# HPA027549, RRID:AB_10603346 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845619
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MCEMP1
Proper citation: Atlas Antibodies Cat# HPA014731, RRID:AB_1845619 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078717
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EBP
Proper citation: Atlas Antibodies Cat# HPA003130, RRID:AB_1078717 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681521
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RPN1
Proper citation: Atlas Antibodies Cat# HPA051520, RRID:AB_2681521 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794990
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): OAS3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041253, RRID:AB_10794990 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079508
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human NSF
Proper citation: Sigma-Aldrich Cat# HPA003154, RRID:AB_1079508 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855322
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQD; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): PLCE1
Proper citation: Atlas Antibodies Cat# HPA015598, RRID:AB_1855322 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963694
Comments:
Host Organism:
Clonality polyclonal
Target(s): FITM2 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA044725, RRID:AB_10963694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845673
Comments: Originating manufacturer of this product. Applications: WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RBCK1
Proper citation: Atlas Antibodies Cat# HPA024185, RRID:AB_1845673 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844758
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ALOX15
Proper citation: Atlas Antibodies Cat# HPA013859, RRID:AB_1844758 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959525
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): UNC5D antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042940, RRID:AB_10959525 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960358
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): NXPH1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020062, RRID:AB_10960358 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11039415
Comments: Applications: Western Blot, Simple Western, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality polyclonal
Target(s): Integrin alpha 6/CD49f
Proper citation: Novus Cat# NBP1-85747, RRID:AB_11039415 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11205274
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): PKM2
Proper citation: Bethyl Cat# A303-660A, RRID:AB_11205274 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848198
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): EPCAM antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026761, RRID:AB_1848198 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851244
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TIMM21
Proper citation: Atlas Antibodies Cat# HPA010587, RRID:AB_1851244 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078544
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CNOT4
Proper citation: Atlas Antibodies Cat# HPA005737, RRID:AB_1078544 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
