Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 166 showing 3301 ~ 3320 out of 55,392 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

    • RRID:AB_2108768

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2108768

Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot J0512 for liver,GM12878,HepG2,K562,HeLa-S3; status is not eligible for new data,awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): GATA6

Proper citation: Santa Cruz Biotechnology Cat# sc-9055, RRID:AB_2108768 Copy   

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_495522

Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): GNL3

Proper citation: Bethyl Cat# A300-599A, RRID:AB_495522 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10669636

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PERM1

Proper citation: Atlas Antibodies Cat# HPA031711, RRID:AB_10669636 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679058

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AKR1C4

Proper citation: Atlas Antibodies Cat# HPA044720, RRID:AB_2679058 Copy   

    • RRID:AB_2683272

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683272

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PKP2

Proper citation: Atlas Antibodies Cat# HPA056908, RRID:AB_2683272 Copy   

    • RRID:AB_10602706

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602706

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LZIC

Proper citation: Atlas Antibodies Cat# HPA028184, RRID:AB_10602706 Copy   

    • RRID:AB_2616128

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2616128

Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): Hdac3

Proper citation: Kevin White Cat# non-commercial Hdac3 modENCODE antibody 2, RRID:AB_2616128 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683186

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TAF1L

Proper citation: Atlas Antibodies Cat# HPA056605, RRID:AB_2683186 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678279

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MAGOH

Proper citation: Atlas Antibodies Cat# HPA043036, RRID:AB_2678279 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681240

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF789

Proper citation: Atlas Antibodies Cat# HPA050793, RRID:AB_2681240 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681855

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): XAGE2

Proper citation: Atlas Antibodies Cat# HPA052507, RRID:AB_2681855 Copy   

    • RRID:AB_10675948

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10675948

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): FGFR1OP2

Proper citation: Atlas Antibodies Cat# HPA038696, RRID:AB_10675948 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682654

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATMIN

Proper citation: Atlas Antibodies Cat# HPA054967, RRID:AB_2682654 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686240

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SC5D

Proper citation: Atlas Antibodies Cat# HPA070248, RRID:AB_2686240 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079310

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MARK1

Proper citation: Atlas Antibodies Cat# HPA008061, RRID:AB_1079310 Copy   

    • RRID:AB_10672460

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672460

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MKRN2

Proper citation: Atlas Antibodies Cat# HPA037559, RRID:AB_10672460 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677686

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MKLN1

Proper citation: Atlas Antibodies Cat# HPA041810, RRID:AB_2677686 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2672945

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBC1D25

Proper citation: Atlas Antibodies Cat# HPA029197, RRID:AB_2672945 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079283

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GMCPLNTPQQALDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFSIADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVVCSS; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): LRRK1

Proper citation: Atlas Antibodies Cat# HPA010537, RRID:AB_1079283 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10793957

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MAST2

Proper citation: Atlas Antibodies Cat# HPA040155, RRID:AB_10793957 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch