Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2687101
Comments: Applications: FC
Host Organism: goat
Clonality: polyclonal
Target(s): IgG
Proper citation: BioLegend Cat# 405432, RRID:AB_2687101 Copy
http://antibodyregistry.org/AB_2686965
Comments: Applications: WB
Host Organism: Mouse
Clonality: monoclonal
Target(s): NTRK2
Proper citation: BioLegend Cat# 695102, RRID:AB_2686965 Copy
http://antibodyregistry.org/AB_2686931
Comments: Applications: ICC, ICFC, 3D IHC, IHC-P
Host Organism: mouse
Clonality: monoclonal
Target(s): Tubulin beta-3
Proper citation: BioLegend Cat# 801210, RRID:AB_2686931 Copy
http://antibodyregistry.org/AB_2686911
Comments: Applications: IB, ICC
Validation status: IF or IB (Pass), IB in brain (Pass), IHC in brain (Fail), KO (ND)
This clone is associated with these products: purified (Antibodies Incorporated, Cat# 75-436, RRID:AB_2686911), supernatant (Antibodies Incorporated, Cat# 73-436, RRID:AB_2532092), hybridoma (UC Davis/NIH NeuroMab Facility, Cat# N449/73, RRID:AB_2877216)
Host Organism: mouse
Clonality: monoclonal
Target(s): Slc18a2/VMAT2
Proper citation: Antibodies Incorporated Cat# 75-436, RRID:AB_2686911 Copy
http://antibodyregistry.org/AB_2686961
Comments: Applications: ELISA Detection
Host Organism: Goat
Clonality: polyclonal
Target(s): MIF
Proper citation: BioLegend Cat# 524004, RRID:AB_2686961 Copy
http://antibodyregistry.org/AB_2687078
Comments: Applications: FC
Host Organism: armenian hamster
Clonality: monoclonal
Target(s): CD278
Proper citation: BioLegend Cat# 313537, RRID:AB_2687078 Copy
http://antibodyregistry.org/AB_2686918
Comments: Vendor approved applications: ELISA, IHC, IP, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): Mu-type opioid receptor isoform MOR-1i protein
Proper citation: Fabgennix Cat# MOR1-FITC, RRID:AB_2686918 Copy
http://antibodyregistry.org/AB_2687100
Comments: Applications: FC
Host Organism: goat
Clonality: polyclonal
Target(s): IgG
Proper citation: BioLegend Cat# 405430, RRID:AB_2687100 Copy
http://antibodyregistry.org/AB_2686895
Comments: Image validation for WB, IHC-P, ICC/IF on MDS.
Host Organism: rabbit
Clonality: monoclonal
Target(s): Human INPPL1
Proper citation: Abcam Cat# ab166916, RRID:AB_2686895 Copy
http://antibodyregistry.org/AB_2686910
Comments: Applications: IB, ICC, IHC
Validation status: IF or IB (Pass), IB in brain (Pass), IHC in brain (Pass), KO (Pass)
This clone is associated with these products: purified (Antibodies Incorporated, Cat# 75-384, RRID:AB_2686910), supernatant (Antibodies Incorporated, Cat# 73-384, RRID:AB_2336904), hybridoma (UC Davis/NIH NeuroMab Facility, Cat# N399/19, RRID:AB_2877202)
Host Organism: mouse
Clonality: monoclonal
Target(s): GABA-A-R-Alpha2
Proper citation: Antibodies Incorporated Cat# 75-384, RRID:AB_2686910 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10696648
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MUT
Proper citation: Atlas Antibodies Cat# HPA035971, RRID:AB_10696648 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673222
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM114A2
Proper citation: Atlas Antibodies Cat# HPA035870, RRID:AB_10673222 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673221
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CPDGFVLKNTQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKS; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): NSG1
Proper citation: Atlas Antibodies Cat# HPA035775, RRID:AB_10673221 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669660
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PAICS
Proper citation: Atlas Antibodies Cat# HPA035895, RRID:AB_10669660 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670021
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PPM1G
Proper citation: Atlas Antibodies Cat# HPA035530, RRID:AB_10670021 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611959
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EDF1
Proper citation: Atlas Antibodies Cat# HPA035642, RRID:AB_10611959 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669975
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CNOT10
Proper citation: Atlas Antibodies Cat# HPA035614, RRID:AB_10669975 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672992
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ALAS1
Proper citation: Atlas Antibodies Cat# HPA035860, RRID:AB_10672992 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601977
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): OLA1
Proper citation: Atlas Antibodies Cat# HPA035790, RRID:AB_10601977 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670023
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FBXL8
Proper citation: Atlas Antibodies Cat# HPA035588, RRID:AB_10670023 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.