Searching across hundreds of databases

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 17 showing 321 ~ 340 out of 3,150,653 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678963

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DCAF13

Proper citation: (Atlas Antibodies Cat# HPA044504, RRID:AB_2678963) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10960884

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): METTL13

Proper citation: (Atlas Antibodies Cat# HPA044498, RRID:AB_10960884) Copy   


  • RRID:AB_2678995

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678995

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): JAKMIP1

Proper citation: (Atlas Antibodies Cat# HPA044570, RRID:AB_2678995) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794895

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OTUD7A

Proper citation: (Atlas Antibodies Cat# HPA044554, RRID:AB_10794895) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679037

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CTTNBP2

Proper citation: (Atlas Antibodies Cat# HPA044654, RRID:AB_2679037) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795881

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CDNF

Proper citation: (Atlas Antibodies Cat# HPA044587, RRID:AB_10795881) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794293

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C6orf132

Proper citation: (Atlas Antibodies Cat# HPA044588, RRID:AB_10794293) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795984

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AFF3

Proper citation: (Atlas Antibodies Cat# HPA044512, RRID:AB_10795984) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679002

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ADH5

Proper citation: (Atlas Antibodies Cat# HPA044578, RRID:AB_2679002) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794053

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GAD2

Proper citation: (Atlas Antibodies Cat# HPA044637, RRID:AB_10794053) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794402

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NDUFC1

Proper citation: (Atlas Antibodies Cat# HPA044556, RRID:AB_10794402) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796803

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GPD1

Proper citation: (Atlas Antibodies Cat# HPA044620, RRID:AB_10796803) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795882

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BBS7

Proper citation: (Atlas Antibodies Cat# HPA044592, RRID:AB_10795882) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794291

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM161B

Proper citation: (Atlas Antibodies Cat# HPA044562, RRID:AB_10794291) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796097

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRAM1L1

Proper citation: (Atlas Antibodies Cat# HPA044560, RRID:AB_10796097) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679050

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): UTP15

Proper citation: (Atlas Antibodies Cat# HPA044697, RRID:AB_2679050) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795987

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPP1R26

Proper citation: (Atlas Antibodies Cat# HPA044686, RRID:AB_10795987) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679035

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGGMESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLST; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): ZBTB18

Proper citation: (Atlas Antibodies Cat# HPA044652, RRID:AB_2679035) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679049

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PNMA5

Proper citation: (Atlas Antibodies Cat# HPA044690, RRID:AB_2679049) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678957

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GSDMD

Proper citation: (Atlas Antibodies Cat# HPA044487, RRID:AB_2678957) Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X