Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 170 showing 3381 ~ 3400 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10669516

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CREB3L4

Proper citation: Atlas Antibodies Cat# HPA038122, RRID:AB_10669516 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847812

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DNMT3A

Proper citation: Sigma-Aldrich Cat# HPA026588, RRID:AB_1847812 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964217

Comments:
Host Organism:
Clonality polyclonal
Target(s): KRTAP20-4 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA045086, RRID:AB_10964217 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852943

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human LMBR1

Proper citation: Sigma-Aldrich Cat# HPA016592, RRID:AB_1852943 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845780

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): C8orf47 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA027233, RRID:AB_1845780 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079236

Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): LASS3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA006092, RRID:AB_1079236 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10960557

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): RAB3IP antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA039794, RRID:AB_10960557 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10962354

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): NSUN6 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045902, RRID:AB_10962354 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964636

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): THAP11 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA042189, RRID:AB_10964636 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10966146

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): STATH antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044569, RRID:AB_10966146 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847292

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DNAJC5

Proper citation: Atlas Antibodies Cat# HPA013154, RRID:AB_1847292 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847434

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): CYP2C8 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA013970, RRID:AB_1847434 Copy   


  • RRID:AB_11172201

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_11172201

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40779 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): DDIT3

Proper citation: GeneTex Cat# GTX109226, RRID:AB_11172201 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848128

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ELMO1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA017941, RRID:AB_1848128 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1119410

Comments: validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, ELISA
Host Organism: mouse
Clonality monoclonal
Target(s): Human BATF

Proper citation: Santa Cruz Biotechnology Cat# sc-100974, RRID:AB_1119410 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2063006

Comments: Used By NYUIHC-1126. Original Manufacturer: Dako. Now part of Agilent.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Endothelial cell membranes obtained as vesicles from human placenta

Proper citation: Agilent Cat# M7165, RRID:AB_2063006 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680454

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNL; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): BCAT1

Proper citation: Atlas Antibodies Cat# HPA048592, RRID:AB_2680454 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2335665

Comments: Used By NYUIHC-787
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism:
Clonality monoclonal
Target(s): ND

Proper citation: Cell Signaling Technology Cat# 9512, RRID:AB_2335665 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845695

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DNAJC28

Proper citation: Sigma-Aldrich Cat# HPA018003, RRID:AB_1845695 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852004

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human JMJD1B

Proper citation: Sigma-Aldrich Cat# HPA016610, RRID:AB_1852004 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X