Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-CREB3L4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038122, RRID:AB_10669516 | CREB3L4 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10669516 | Atlas Antibodies | HPA038122 | 2025-08-20 02:47:47 | 0 | ||
|
Anti-DNMT3A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA026588, RRID:AB_1847812 | Human DNMT3A | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847812 | Sigma-Aldrich | HPA026588 | 2025-08-20 02:47:48 | 0 | ||
|
Anti-KRTAP20-4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA045086, RRID:AB_10964217 | KRTAP20-4 antibody produced in rabbit | human | polyclonal | AB_10964217 | Atlas Antibodies | HPA045086 | 2025-08-20 02:48:00 | 0 | ||||
|
Anti-LMBR1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA016592, RRID:AB_1852943 | Human LMBR1 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1852943 | Sigma-Aldrich | HPA016592 | 2025-08-20 02:48:01 | 0 | ||
|
Anti-C8orf47 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA027233, RRID:AB_1845780 | C8orf47 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1845780 | Sigma-Aldrich | HPA027233 | 2025-08-20 02:48:47 | 0 | ||
|
Anti-LASS3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA006092, RRID:AB_1079236 | LASS3 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1079236 | Sigma-Aldrich | HPA006092 | 2025-08-20 02:48:47 | 0 | ||
|
Anti-RAB3IP antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA039794, RRID:AB_10960557 | RAB3IP antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10960557 | Sigma-Aldrich | HPA039794 | 2025-08-20 02:48:12 | 0 | |||
|
Anti-NSUN6 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045902, RRID:AB_10962354 | NSUN6 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10962354 | Sigma-Aldrich | HPA045902 | 2025-08-20 02:48:50 | 0 | |||
|
Anti-THAP11 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA042189, RRID:AB_10964636 | THAP11 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10964636 | Sigma-Aldrich | HPA042189 | 2025-08-20 02:48:12 | 0 | |||
|
Anti-STATH antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044569, RRID:AB_10966146 | STATH antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10966146 | Sigma-Aldrich | HPA044569 | 2025-08-20 02:48:12 | 0 | |||
|
Anti-DNAJC5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013154, RRID:AB_1847292 | DNAJC5 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1847292 | Atlas Antibodies | HPA013154 | 2025-08-20 02:48:15 | 0 | ||
|
Anti-CYP2C8 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA013970, RRID:AB_1847434 | CYP2C8 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry | polyclonal | rabbit | AB_1847434 | Sigma-Aldrich | HPA013970 | 2025-08-20 02:48:16 | 0 | ||
|
DDIT3-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX109226, RRID:AB_11172201 | DDIT3 | human | ENCODE PROJECT External validation DATA SET is released testing lot 40779 for any cell type or tissues; status is awaiting lab characterization | polyclonal | rabbit | AB_11172201 | GeneTex | GTX109226 | 2025-08-20 02:48:27 | 0 | ||
|
Anti-ELMO1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA017941, RRID:AB_1848128 | ELMO1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry | polyclonal | rabbit | AB_1848128 | Sigma-Aldrich | HPA017941 | 2025-08-20 02:48:29 | 1 | ||
|
Mouse Anti-Human B-ATF Monoclonal Antibody, Unconjugated, Clone WW8 Resource Report Resource Website 1+ mentions Rating or validation data |
Santa Cruz Biotechnology Cat# sc-100974, RRID:AB_1119410 | Human BATF | rat, mouse, human | WW8 | validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, ELISA | monoclonal | mouse | AB_1119410 | Santa Cruz Biotechnology | sc-100974 | 2025-08-20 02:48:30 | 3 | |
|
CD 34, CD 34, Hematopoietic progenitor cell antigen, class II Resource Report Resource Website 1+ mentions Rating or validation data |
Agilent Cat# M7165, RRID:AB_2063006 | Endothelial cell membranes obtained as vesicles from human placenta | QBEnd 10 |
Used By NYUIHC-1126. Original Manufacturer: Dako. Now part of Agilent. Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_2063006 | Agilent | M7165 | 2025-08-20 02:48:40 | 4 | ||
|
Anti-BCAT1 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA048592, RRID:AB_2680454 | BCAT1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNL; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_2680454 | Atlas Antibodies | HPA048592 | 2025-08-20 02:48:55 | 1 | ||
|
Mothers against decapentaplegic homolog 1 Resource Report Resource Website 1+ mentions Rating or validation data |
Cell Signaling Technology Cat# 9512, RRID:AB_2335665 | ND | ND |
Used By NYUIHC-787 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | AB_2335665 | Cell Signaling Technology | 9512 (also 9512S) | 2025-08-20 02:48:51 | 1 | |||
|
Anti-DNAJC28 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA018003, RRID:AB_1845695 | Human DNAJC28 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1845695 | Sigma-Aldrich | HPA018003 | 2025-08-20 02:49:06 | 0 | ||
|
Anti-KDM3B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA016610, RRID:AB_1852004 | Human JMJD1B | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1852004 | Sigma-Aldrich | HPA016610 | 2025-08-20 02:49:03 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
