Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Target Organism:rat (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

673,456 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-ZNF598 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA041896, RRID:AB_10796464 ZNF598 Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10796464 Atlas Antibodies HPA041896 2026-08-29 12:10:13 2
Anti-HIST4H4 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA042201, RRID:AB_2677898 HIST4H4 Human, Rat, Mouse Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677898 Atlas Antibodies HPA042201 2026-08-31 06:33:22 1
Anti-CIAPIN1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA042182, RRID:AB_10794646 CIAPIN1 Human, Rat, Mouse Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794646 Atlas Antibodies HPA042182 2026-08-29 01:17:31 1
Anti-SNRK polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042163, RRID:AB_10794645 SNRK rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794645 Atlas Antibodies HPA042163 2026-08-29 04:32:46 0
Anti-DUS3L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041854, RRID:AB_10794493 DUS3L rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794493 Atlas Antibodies HPA041854 2026-08-29 12:39:09 0
Anti-NAE1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042041, RRID:AB_10964772 NAE1 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10964772 Atlas Antibodies HPA042041 2026-08-31 06:12:36 0
Anti-MRPS34 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042112, RRID:AB_10796899 MRPS34 Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10796899 Atlas Antibodies HPA042112 2026-08-31 09:09:29 0
Anti-PPP2R2B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042122, RRID:AB_2677859 PPP2R2B rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677859 Atlas Antibodies HPA042122 2026-08-29 08:19:49 0
Anti-POLR2C
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041826, RRID:AB_10793935 POLR2C rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10793935 Atlas Antibodies HPA041826 2026-08-31 09:07:12 0
Anti-TCF25
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041786, RRID:AB_10960526 TCF25 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10960526 Atlas Antibodies HPA041786 2026-08-29 02:29:04 0
Anti-LCMT1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041559, RRID:AB_2677548 LCMT1 Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677548 Atlas Antibodies HPA041559 2026-08-31 08:00:02 0
Anti-IDH3A
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041465, RRID:AB_10794377 IDH3A rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794377 Atlas Antibodies HPA041465 2026-08-28 04:03:19 0
Anti-TRAPPC2L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041714, RRID:AB_10793930 TRAPPC2L rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10793930 Atlas Antibodies HPA041714 2026-08-29 05:03:10 0
Anti-SNRPD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041437, RRID:AB_10795119 SNRPD2 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795119 Atlas Antibodies HPA041437 2026-08-31 09:07:11 0
Anti-SLC12A7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041652, RRID:AB_10793971 SLC12A7 Human, Rat, Mouse Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10793971 Atlas Antibodies HPA041652 2026-08-31 02:41:25 0
Anti-POLR3E
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041477, RRID:AB_10796345 POLR3E rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10796345 Atlas Antibodies HPA041477 2026-08-31 02:11:15 0
Anti-NDUFA8
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041510, RRID:AB_10794379 NDUFA8 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794379 Atlas Antibodies HPA041510 2026-08-31 11:38:10 0
Anti-NDUFA8
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041600, RRID:AB_10796778 NDUFA8 rat, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10796778 Atlas Antibodies HPA041600 2026-08-31 01:05:15 0
Anti-CCBE1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041374, RRID:AB_10794515 CCBE1 Human, Rat, Mouse Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRA; Manufacturer approved use: ICC-IF, IHC, WB polyclonal rabbit AB_10794515 Atlas Antibodies HPA041374 2026-08-29 06:50:03 0
Anti-DHX38 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041347, RRID:AB_10796571 DHX38 Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10796571 Atlas Antibodies HPA041347 2026-08-29 03:03:44 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.