Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-ZP3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054061, RRID:AB_2682363 ZP3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682363 Atlas Antibodies HPA054061 2025-08-20 04:02:36 0
Anti-LARP4 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA039306, RRID:AB_10805362 LARP4 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10805362 Atlas Antibodies HPA039306 2025-08-20 04:02:41 1
Anti-MUC21 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052028, RRID:AB_2681700 MUC21 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681700 Atlas Antibodies HPA052028 2025-08-20 04:02:36 0
Anti-MYPOP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA065307, RRID:AB_2685460 MYPOP human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685460 Atlas Antibodies HPA065307 2025-08-20 04:02:41 0
Anti-PLEKHN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031742, RRID:AB_10670704 PLEKHN1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670704 Atlas Antibodies HPA031742 2025-08-20 04:02:35 0
Anti-JCHAIN polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044132, RRID:AB_2678826 JCHAIN human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678826 Atlas Antibodies HPA044132 2025-08-20 04:02:36 0
Anti-PPP2R5D
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029045, RRID:AB_10598912 PPP2R5D rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10598912 Atlas Antibodies HPA029045 2025-08-20 04:02:41 0
Anti-BCL6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA004899, RRID:AB_1078273 BCL6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078273 Atlas Antibodies HPA004899 2025-08-20 04:02:35 0
Anti-SLC7A7
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036227, RRID:AB_10696653 SLC7A7 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10696653 Atlas Antibodies HPA036227 2025-08-20 04:02:41 0
Anti-IGHMBP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA060994, RRID:AB_2684406 IGHMBP2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684406 Atlas Antibodies HPA060994 2025-08-20 04:02:36 0
Anti-FSTL5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045909, RRID:AB_2679494 FSTL5 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYK; Manufacturer approved use: IHC, WB polyclonal rabbit AB_2679494 Atlas Antibodies HPA045909 2025-08-20 04:02:41 0
Anti-TIPARP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036796, RRID:AB_10672268 TIPARP human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10672268 Atlas Antibodies HPA036796 2025-08-20 04:02:36 0
Anti-KIAA0907 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA008796, RRID:AB_1079369 KIAA0907 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079369 Atlas Antibodies HPA008796 2025-08-20 04:02:43 0
Anti-ABHD6 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA017283, RRID:AB_1844452 ABHD6 human polyclonal rabbit AB_1844452 Atlas Antibodies HPA017283 2025-08-20 04:02:44 0
Anti-KIF18B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027831, RRID:AB_2131406 KIF18B human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PVTRTMARRLSGPLHTLGIPPGPNCTPAQGSRWPMEKKRRRPSALEADSPMAPKRGTKRQRQSFLPCLRRGSLPDTQPSQGPSTPKGERASSPCHSPRVCPATV; Manufacturer approved use: IHC polyclonal rabbit AB_2131406 Atlas Antibodies HPA027831 2025-08-20 04:02:46 0
Anti-ZNF704 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA024302, RRID:AB_1859427 Human ZNF704 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1859427 Sigma-Aldrich HPA024302 2025-08-20 04:02:53 0
Anti-DHX34 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043558, RRID:AB_10961262 DHX34 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10961262 Sigma-Aldrich HPA043558 2025-08-20 04:03:14 0
Anti-BDH1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA030947, RRID:AB_10669548 BDH1 Human, Rat Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669548 Atlas Antibodies HPA030947 2025-08-20 04:03:22 1
H3K4me3-human
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Diagenode Cat# pAb-003-050, RRID:AB_2616052 H3K4me3 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot A5051-001P for any cell type and tissues; status is eligible for new data polyclonal rabbit AB_2616052 Diagenode pAb-003-050 (also C15410003-50, C15410003-10, ENCAB000BKU) 2025-08-20 04:03:40 43
Anti-KBTBD5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA024463, RRID:AB_1852095 Human KBTBD5 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1852095 Sigma-Aldrich HPA024463 2025-08-20 04:03:44 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.