Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849230
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human GNAI2
Proper citation: Sigma-Aldrich Cat# HPA007704, RRID:AB_1849230 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11218591
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): FASTKD2
Proper citation: Thermo Fisher Scientific Cat# A303-788A, RRID:AB_11218591 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_841465
Comments: manufacturer recommendations: IgG Western Blot; ELISA; WB, IHC; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615119, AB_841465.
Host Organism: rabbit
Clonality unknown
Target(s): HNRPA0 (heterogeneous nuclear ribonucleoprotein A0) (against the middle region of HNRPA0) (100ug)
Proper citation: Aviva Systems Biology Cat# ARP40686_T100, RRID:AB_841465 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682306
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC137
Proper citation: Atlas Antibodies Cat# HPA053914, RRID:AB_2682306 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670120
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LRRC34
Proper citation: Atlas Antibodies Cat# HPA035747, RRID:AB_10670120 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682332
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CARD16
Proper citation: Atlas Antibodies Cat# HPA053981, RRID:AB_2682332 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2669476
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA0040
Proper citation: Atlas Antibodies Cat# HPA016895, RRID:AB_2669476 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335877
Comments: Used By NYUIHC-913
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): Alcohol Dehydrogenase (Yeast)
Proper citation: Polysciences Cat# 23717, RRID:AB_2335877 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965838
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TSPYL2
Proper citation: Atlas Antibodies Cat# HPA044133, RRID:AB_10965838 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679762
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SUCLG2
Proper citation: Atlas Antibodies Cat# HPA046705, RRID:AB_2679762 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846097
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CBLB antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018327, RRID:AB_1846097 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846065
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): CTNNA3
Proper citation: Atlas Antibodies Cat# HPA017977, RRID:AB_1846065 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673711
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM131C
Proper citation: Atlas Antibodies Cat# HPA031046, RRID:AB_2673711 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10805599
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PRIM1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040010, RRID:AB_10805599 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10966140
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): BEST2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046229, RRID:AB_10966140 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965696
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): GPATCH8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044380, RRID:AB_10965696 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845944
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human CAMK2D
Proper citation: Sigma-Aldrich Cat# HPA026281, RRID:AB_1845944 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11178895
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40688 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): PTBP3
Proper citation: GeneTex Cat# GTX115327, RRID:AB_11178895 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853866
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human C1orf64
Proper citation: Sigma-Aldrich Cat# HPA026676, RRID:AB_1853866 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858944
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ZBTB2
Proper citation: Sigma-Aldrich Cat# HPA023458, RRID:AB_1858944 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
