Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599298
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): GLT25D2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031749, RRID:AB_10599298 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794042
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): COMTD1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042165, RRID:AB_10794042 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080357
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human TF
Proper citation: Sigma-Aldrich Cat# HPA001527, RRID:AB_1080357 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078840
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human FCN1
Proper citation: Sigma-Aldrich Cat# HPA000685, RRID:AB_1078840 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335999
Comments: Used By NYUIHC-1208
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: Ventana Medical Systems Cat# 760-4257, RRID:AB_2335999 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856540
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ADCY10
Proper citation: Sigma-Aldrich Cat# HPA015243, RRID:AB_1856540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847248
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human AC005921.3-1
Proper citation: Sigma-Aldrich Cat# HPA018484, RRID:AB_1847248 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2215267
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR31
Proper citation: Sigma-Aldrich Cat# HPA019347, RRID:AB_2215267 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667382
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MIXL1
Proper citation: Atlas Antibodies Cat# HPA005662, RRID:AB_2667382 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079132
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): IL12A
Proper citation: Atlas Antibodies Cat# HPA001886, RRID:AB_1079132 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079706
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PSMC3
Proper citation: Atlas Antibodies Cat# HPA006065, RRID:AB_1079706 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078565
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CRELD2
Proper citation: Atlas Antibodies Cat# HPA000603, RRID:AB_1078565 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078966
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GIT1
Proper citation: Atlas Antibodies Cat# HPA004059, RRID:AB_1078966 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078081
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ABHD4
Proper citation: Atlas Antibodies Cat# HPA000600, RRID:AB_1078081 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603341
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPTA1
Proper citation: Atlas Antibodies Cat# HPA028048, RRID:AB_10603341 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599855
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF710
Proper citation: Atlas Antibodies Cat# HPA030227, RRID:AB_10599855 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602001
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LTV1
Proper citation: Atlas Antibodies Cat# HPA030161, RRID:AB_10602001 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847785
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POLH
Proper citation: Atlas Antibodies Cat# HPA006721, RRID:AB_1847785 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670657
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TSHZ2
Proper citation: Atlas Antibodies Cat# HPA038123, RRID:AB_10670657 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10609996
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KCNV2
Proper citation: Atlas Antibodies Cat# HPA031131, RRID:AB_10609996 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.