Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856540
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): ADCY10 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015243, RRID:AB_1856540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856555
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human SAMD9L
Proper citation: Sigma-Aldrich Cat# HPA019461, RRID:AB_1856555 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2097450
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): EFCAB3
Proper citation: Sigma-Aldrich Cat# HPA023317, RRID:AB_2097450 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854981
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): PARP14 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012063, RRID:AB_1854981 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857186
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC4A11 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018120, RRID:AB_1857186 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_449854
Comments: ENCODE PROJECT External validation for lot# GR38973-3 is available under ENCODE ID: ENCAB638TXJ
Host Organism: mouse
Clonality monoclonal
Target(s): H3K9me2
Proper citation: Abcam Cat# ab1220, RRID:AB_449854 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_650287
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA
Host Organism: goat
Clonality polyclonal
Target(s): NKX6-1
Proper citation: Santa Cruz Biotechnology Cat# sc-15030, RRID:AB_650287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079888
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SDF2L1
Proper citation: Atlas Antibodies Cat# HPA005638, RRID:AB_1079888 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847484
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): DAT
Proper citation: Atlas Antibodies Cat# HPA013602, RRID:AB_1847484 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080736
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF550
Proper citation: Atlas Antibodies Cat# HPA003251, RRID:AB_1080736 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849868
Comments: Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Host Organism: rabbit
Clonality polyclonal
Target(s): RACK1
Proper citation: Atlas Antibodies Cat# HPA021676, RRID:AB_1849868 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845798
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTRH1
Proper citation: Atlas Antibodies Cat# HPA021223, RRID:AB_1845798 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670042
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ARHGAP28
Proper citation: Atlas Antibodies Cat# HPA030414, RRID:AB_10670042 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078356
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): C6orf117, MRAP2
Proper citation: Atlas Antibodies Cat# HPA008966, RRID:AB_1078356 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2665496
Comments: Applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunoblotting
Host Organism: Rabbit
Clonality polyclonal
Target(s): ALDH1A3
Proper citation: Novus Cat# NBP2-15339, RRID:AB_2665496 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854219
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human MUTYH
Proper citation: Sigma-Aldrich Cat# HPA008732, RRID:AB_1854219 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854696
Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): NUDT1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012636, RRID:AB_1854696 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1163601
Comments: Vendor recommendations: IgG
Host Organism: goat
Clonality unknown
Target(s): IgG from goat serum
Proper citation: Sigma-Aldrich Cat# I9140, RRID:AB_1163601 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11170466
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40660 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): EZR
Proper citation: GeneTex Cat# GTX111709, RRID:AB_11170466 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672870
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PFN2
Proper citation: Atlas Antibodies Cat# HPA035611, RRID:AB_10672870 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
