Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-ADCY10 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015243, RRID:AB_1856540 | ADCY10 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1856540 | Sigma-Aldrich | HPA015243 | 2025-08-20 04:00:47 | 0 | ||
|
Anti-SAMD9L antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA019461, RRID:AB_1856555 | Human SAMD9L | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1856555 | Sigma-Aldrich | HPA019461 | 2025-08-20 04:01:04 | 0 | ||
|
Anti-EFCAB3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA023317, RRID:AB_2097450 | EFCAB3 | human | Useful for immunohistochemistry | polyclonal | rabbit | AB_2097450 | Sigma-Aldrich | HPA023317 | 2025-08-20 04:01:18 | 0 | ||
|
Anti-PARP14 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012063, RRID:AB_1854981 | PARP14 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot | polyclonal | rabbit | AB_1854981 | Sigma-Aldrich | HPA012063 | 2025-08-20 04:01:15 | 0 | ||
|
Anti-SLC4A11 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA018120, RRID:AB_1857186 | SLC4A11 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1857186 | Sigma-Aldrich | HPA018120 | 2025-08-20 04:01:11 | 0 | ||
|
H3K9me2-dmelanogaster Resource Report Resource Website 100+ mentions Rating or validation data |
Abcam Cat# ab1220, RRID:AB_449854 | H3K9me2 | drosophila melanogaster | Clone mAbcam 1220 | ENCODE PROJECT External validation for lot# GR38973-3 is available under ENCODE ID: ENCAB638TXJ | monoclonal | mouse | AB_449854 | Abcam | ab1220 | 2025-08-20 04:00:56 | 106 | |
|
Nkx-6.1 (C-14) Resource Report Resource Website Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-15030, RRID:AB_650287 | NKX6-1 | rat, mouse, human | C-14 | Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA | polyclonal | goat | AB_650287 | Santa Cruz Biotechnology | sc-15030 | 2025-08-20 04:01:39 | 0 | |
|
Anti-SDF2L1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA005638, RRID:AB_1079888 | SDF2L1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1079888 | Atlas Antibodies | HPA005638 | 2025-08-20 04:01:32 | 0 | ||
|
Anti-DAT polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013602, RRID:AB_1847484 | DAT | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG; Manufacturer approved use: IHC | polyclonal | rabbit | AB_1847484 | Atlas Antibodies | HPA013602 | 2025-08-20 04:01:32 | 0 | ||
|
Anti-ZNF550 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA003251, RRID:AB_1080736 | ZNF550 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1080736 | Atlas Antibodies | HPA003251 | 2025-08-20 04:01:31 | 0 | ||
|
Anti-GNB2L1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021676, RRID:AB_1849868 | RACK1 | rat, mouse, human | Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence | polyclonal | rabbit | AB_1849868 | Atlas Antibodies | HPA021676 | 2025-08-20 04:01:41 | 0 | ||
|
Anti-PTRH1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021223, RRID:AB_1845798 | PTRH1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845798 | Atlas Antibodies | HPA021223 | 2025-08-20 04:02:02 | 0 | ||
|
Anti-ARHGAP28 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA030414, RRID:AB_10670042 | ARHGAP28 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10670042 | Atlas Antibodies | HPA030414 | 2025-08-20 04:01:33 | 0 | ||
|
Anti-MRAP2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA008966, RRID:AB_1078356 | C6orf117, MRAP2 | human | polyclonal | rabbit | AB_1078356 | Atlas Antibodies | HPA008966 | 2025-08-20 04:01:46 | 0 | |||
|
ALDH1A3 Antibody - BSA Free Resource Report Resource Website 1+ mentions Rating or validation data |
Novus Cat# NBP2-15339, RRID:AB_2665496 | ALDH1A3 | Human, Rat, Mouse | Applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunoblotting | polyclonal | Rabbit | AB_2665496 | Novus | NBP2-15339 (also NBP2-15339SS) | 2025-08-20 04:02:01 | 7 | ||
|
Anti-MUTYH antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA008732, RRID:AB_1854219 | Human MUTYH | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854219 | Sigma-Aldrich | HPA008732 | 2025-08-20 04:02:04 | 0 | ||
|
Anti-NUDT1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012636, RRID:AB_1854696 | NUDT1 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1854696 | Sigma-Aldrich | HPA012636 | 2025-08-20 03:59:49 | 0 | ||
|
IgG from goat serum Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# I9140, RRID:AB_1163601 | IgG from goat serum | Vendor recommendations: IgG | unknown | goat | AB_1163601 | Sigma-Aldrich | I9140 | 2025-08-20 03:59:33 | 0 | |||
|
EZR-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX111709, RRID:AB_11170466 | EZR | rat, mouse, human | ENCODE PROJECT External validation DATA SET is released testing lot 40660 for not specified; status is not pursued | polyclonal | rabbit | AB_11170466 | GeneTex | GTX111709 | 2025-08-20 03:59:36 | 0 | ||
|
Anti-PFN2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA035611, RRID:AB_10672870 | PFN2 | rat, mouse, human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10672870 | Atlas Antibodies | HPA035611 | 2025-08-20 03:59:51 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
