Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_627647
Comments: ENCODE PROJECT External validation DATA SET is released testing lot F1804 for A-431,NIH3T3,liver,K562,HeLa-S3; status is awaiting lab characterization
Host Organism: mouse
Clonality monoclonal
Target(s): GABPA
Proper citation: Santa Cruz Biotechnology Cat# sc-28312, RRID:AB_627647 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964358
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CHMP2A
Proper citation: Atlas Antibodies Cat# HPA041153, RRID:AB_10964358 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732624
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): GUCY1A3
Proper citation: Atlas Antibodies Cat# HPA058617, RRID:AB_2732624 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964774
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POP4
Proper citation: Atlas Antibodies Cat# HPA042748, RRID:AB_10964774 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679531
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC29A3
Proper citation: Atlas Antibodies Cat# HPA046085, RRID:AB_2679531 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962145
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): CTC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044349, RRID:AB_10962145 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602097
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): RGN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029103, RRID:AB_10602097 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2147995
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LRLLHLEGNLLHQLHPSTFSTFTFLDYFRLSTIRHLYLAENMVRTLPASMLRNMPLLENLYLQGNPWTCDCEMRWFLEWDAKSRGILKCKKDKAYEGGQLCAMCFSPKKLYKHEIHKLKDMTCL; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): MXRA5
Proper citation: Atlas Antibodies Cat# HPA000508, RRID:AB_2147995 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854982
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PARP14
Proper citation: Sigma-Aldrich Cat# HPA008846, RRID:AB_1854982 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2176125
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): RAC1, RAC3
Proper citation: Santa Cruz Biotechnology Cat# sc-95, RRID:AB_2176125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845125
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ATAD2
Proper citation: Sigma-Aldrich Cat# HPA019860, RRID:AB_1845125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961638
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): CPSF4L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044047, RRID:AB_10961638 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964261
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): SMG6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042932, RRID:AB_10964261 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961400
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): SDR39U1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044294, RRID:AB_10961400 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10967609
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): CNPY2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038465, RRID:AB_10967609 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963057
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): HS6ST1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044586, RRID:AB_10963057 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959590
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): DTYMK antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042593, RRID:AB_10959590 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959448
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): NDUFB6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044001, RRID:AB_10959448 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10970752
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): FXYD6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041334, RRID:AB_10970752 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10966720
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): LDHC antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045442, RRID:AB_10966720 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.