Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795033
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUOM
Proper citation: Atlas Antibodies Cat# HPA039207, RRID:AB_10795033 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684227
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWEILSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFAT; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): AMHR2
Proper citation: Atlas Antibodies Cat# HPA060228, RRID:AB_2684227 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845448
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s):
Proper citation: Atlas Antibodies Cat# HPA019637, RRID:AB_1845448 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672840
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): RAD54L
Proper citation: Sigma-Aldrich Cat# HPA028954, RRID:AB_2672840 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_609461
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): JMJD2A
Proper citation: Bethyl Cat# A300-861A, RRID:AB_609461 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_842575
Comments: manufacturer recommendations: ELISA; Western Blot; Western Blot, ELISA; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615121, AB_842575.
Host Organism: rabbit
Clonality polyclonal
Target(s): Human SYNCRIP
Proper citation: Aviva Systems Biology Cat# ARP40640_T100, RRID:AB_842575 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848299
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human EVC
Proper citation: Sigma-Aldrich Cat# HPA016046, RRID:AB_1848299 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673704
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ALB
Proper citation: Atlas Antibodies Cat# HPA031025, RRID:AB_2673704 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685960
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF286B
Proper citation: Atlas Antibodies Cat# HPA068125, RRID:AB_2685960 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686292
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM71
Proper citation: Atlas Antibodies Cat# HPA070655, RRID:AB_2686292 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620323
Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): NIP7
Proper citation: Bethyl Cat# A303-974A, RRID:AB_2620323 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859075
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZMYM6
Proper citation: Atlas Antibodies Cat# HPA011004, RRID:AB_1859075 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681155
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HSD3B7
Proper citation: Atlas Antibodies Cat# HPA050521, RRID:AB_2681155 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683697
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SRRT
Proper citation: Atlas Antibodies Cat# HPA058379, RRID:AB_2683697 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078469
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ITGA5
Proper citation: Atlas Antibodies Cat# HPA002642, RRID:AB_1078469 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669523
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PCGF5
Proper citation: Atlas Antibodies Cat# HPA038349, RRID:AB_10669523 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685402
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PGBD5
Proper citation: Atlas Antibodies Cat# HPA065010, RRID:AB_2685402 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078087
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACADM
Proper citation: Atlas Antibodies Cat# HPA006198, RRID:AB_1078087 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669980
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LYAR
Proper citation: Atlas Antibodies Cat# HPA035881, RRID:AB_10669980 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732674
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ADRB3
Proper citation: Atlas Antibodies Cat# HPA061969, RRID:AB_2732674 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.