Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_10811829
Comments: manufacturer recommendations: Western Blot; WB
Host Organism: rabbit
Clonality polyclonal
Target(s): EML3 antibody
Proper citation: Fitzgerald Industries International Cat# 70R-4256, RRID:AB_10811829 Copy
http://antibodyregistry.org/AB_10827086
Comments: manufacturer recommendations: Immunocytochemistry (ICC),Western Blotting (WB),Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)),Agonist (Agon); Immunocytochemistry; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): anti-Ubiquitin Carboxyl-terminal Hydrolase CYLD (CYLD) antibody
Proper citation: Antibodies-Online Cat# ABIN461715, RRID:AB_10827086 Copy
http://antibodyregistry.org/AB_2764067
Comments: Applications:WB
Host Organism: rabbit
Clonality polyclonal
Target(s): IL13RA2
Proper citation: ABclonal Cat# A2043, RRID:AB_2764067 Copy
http://antibodyregistry.org/AB_735427
Comments: manufacturer recommendations: ELISA; Immunocytochemistry; Western Blot; IKAP antibody can be used for detection of IKAP by Western blot at 0.5 to 1 & 956;g/mL. E, WB, ICC
Host Organism: rabbit
Clonality unknown
Target(s): IKAP
Proper citation: ProSci Cat# 2337, RRID:AB_735427 Copy
http://antibodyregistry.org/AB_2769749
Comments: Applications: WB
Host Organism: rabbit
Clonality polyclonal
Target(s): HCRTR1
Proper citation: ABclonal Cat# A9349, RRID:AB_2769749 Copy
http://antibodyregistry.org/AB_1674968
Comments: manufacturer recommendations: Immunofluorescence; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): FIS1
Proper citation: Abnova Cat# PAB8718, RRID:AB_1674968 Copy
http://antibodyregistry.org/AB_10813074
Comments: manufacturer recommendations: Western Blot; WB
Host Organism: rabbit
Clonality polyclonal
Target(s): SAA4 antibody
Proper citation: Fitzgerald Industries International Cat# 70R-5924, RRID:AB_10813074 Copy
http://antibodyregistry.org/AB_10823958
Comments: manufacturer recommendations: Western Blot; Immunohistochemistry; Western Blotting (WB),Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Host Organism: rabbit
Clonality polyclonal
Target(s): anti-CD9 (CD9) antibody
Proper citation: Antibodies-Online Cat# ABIN213766, RRID:AB_10823958 Copy
http://antibodyregistry.org/AB_1675067
Comments: manufacturer recommendations: Immunohistochemistry; Immunohistochemistry-P
Host Organism: rabbit
Clonality polyclonal
Target(s): FGFR1
Proper citation: Abnova Cat# PAB11876, RRID:AB_1675067 Copy
http://antibodyregistry.org/AB_10861257
Comments: validation status unknown, seller recommendations provided in 2012: Flow Cytometry; Western Blot; Flow Cyt, WB
Host Organism: rabbit
Clonality monoclonal
Target(s): PAX6 antibody [EPR3352(2)]
Proper citation: Abcam Cat# ab109233, RRID:AB_10861257 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681869
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBC1D3L
Proper citation: Atlas Antibodies Cat# HPA052553, RRID:AB_2681869 Copy
http://antibodyregistry.org/AB_2035301
Comments: manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; ELISA, Paraffin sections, Western Blot
Host Organism: rabbit
Clonality unknown
Target(s): CD282 / TLR2
Proper citation: Acris Antibodies Cat# AP09340PU-N, RRID:AB_2035301 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601126
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): CFAP77
Proper citation: Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 Copy
http://antibodyregistry.org/AB_1091590
Comments: manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; Immunohistochemistry, Western Blot, ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): ErbB-2 (Her-2), phospho (Tyr1248)
Proper citation: AnaSpec; EGT Group Cat# 29607-025, RRID:AB_1091590 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845581
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CMC2
Proper citation: Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 Copy
http://antibodyregistry.org/AB_2765772
Comments: Applications:WB
Host Organism: rabbit
Clonality polyclonal
Target(s): MOB4
Proper citation: ABclonal Cat# A4590, RRID:AB_2765772 Copy
http://antibodyregistry.org/AB_1652990
Comments: vendor suggested use: Immunohistochemistry; Immunohistochemistry (Parrafin)
Host Organism: rabbit
Clonality polyclonal
Target(s): Human Human IgE
Proper citation: LSBio (LifeSpan) Cat# LS-C68500-250, RRID:AB_1652990 Copy
http://antibodyregistry.org/AB_2304710
Comments: manufacturer recommendations: IgG Immunohistochemistry; Western Blot; ELISA; E, WB, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF300
Proper citation: Abbiotec Cat# 250541, RRID:AB_2304710 Copy
http://antibodyregistry.org/AB_1192027
Comments: vendor suggested use: Western Blot; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): Mouse Focal Adhesion Kinase 1 (PTK2, FAK1)
Proper citation: LSBio (LifeSpan) Cat# LS-C41215-50, RRID:AB_1192027 Copy
Discontinued
http://antibodyregistry.org/AB_11393058
Comments: Discontinued: 2015; Discontinued on 27 July 2015; IHC-P
Host Organism: rabbit
Clonality polyclonal
Target(s): Gclc
Proper citation: Creative Biomart Cat# DPABT-H10262, RRID:AB_11393058 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.