Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
EML3 antibody Resource Report Resource Website |
Fitzgerald Industries International Cat# 70R-4256, RRID:AB_10811829 | EML3 antibody | mouse, human | manufacturer recommendations: Western Blot; WB | polyclonal | rabbit | AB_10811829 | Fitzgerald Industries International | 70R-4256 | 2025-08-19 10:31:52 | 0 | ||
|
anti-Ubiquitin Carboxyl-terminal Hydrolase CYLD (CYLD) antibody Resource Report Resource Website |
Antibodies-Online Cat# ABIN461715, RRID:AB_10827086 | anti-Ubiquitin Carboxyl-terminal Hydrolase CYLD (CYLD) antibody | human | manufacturer recommendations: Immunocytochemistry (ICC),Western Blotting (WB),Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)),Agonist (Agon); Immunocytochemistry; Western Blot; Immunohistochemistry | polyclonal | rabbit | AB_10827086 | Antibodies-Online | ABIN461715 | 2025-08-19 10:32:15 | 0 | ||
|
IL13RA2 Polyclonal Antibody Resource Report Resource Website |
ABclonal Cat# A2043, RRID:AB_2764067 | IL13RA2 | rat, mouse, human | Applications:WB | polyclonal | rabbit | AB_2764067 | ABclonal | A2043 | 2025-08-19 10:31:54 | 0 | ||
|
IKAP Antibody Resource Report Resource Website |
ProSci Cat# 2337, RRID:AB_735427 | IKAP | h, m, mouse, human | manufacturer recommendations: ELISA; Immunocytochemistry; Western Blot; IKAP antibody can be used for detection of IKAP by Western blot at 0.5 to 1 & 956;g/mL. E, WB, ICC | unknown | rabbit | AB_735427 | ProSci | 2337 | 2025-08-19 10:32:21 | 0 | ||
|
HCRTR1 Polyclonal Antibody Resource Report Resource Website |
ABclonal Cat# A9349, RRID:AB_2769749 | HCRTR1 | human | Applications: WB | polyclonal | rabbit | AB_2769749 | ABclonal | A9349 | 2025-08-19 10:31:55 | 0 | ||
|
Rabbit Anti-FIS1 Polyclonal Antibody, Unconjugated Resource Report Resource Website |
Abnova Cat# PAB8718, RRID:AB_1674968 | FIS1 | manufacturer recommendations: Immunofluorescence; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot | polyclonal | rabbit | AB_1674968 | Abnova | PAB8718 | 2025-08-19 10:32:18 | 0 | |||
|
SAA4 antibody Resource Report Resource Website |
Fitzgerald Industries International Cat# 70R-5924, RRID:AB_10813074 | SAA4 antibody | human | manufacturer recommendations: Western Blot; WB | polyclonal | rabbit | AB_10813074 | Fitzgerald Industries International | 70R-5924 | 2025-08-19 10:31:52 | 0 | ||
|
anti-CD9 (CD9) antibody Resource Report Resource Website |
Antibodies-Online Cat# ABIN213766, RRID:AB_10823958 | anti-CD9 (CD9) antibody | human | manufacturer recommendations: Western Blot; Immunohistochemistry; Western Blotting (WB),Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) | polyclonal | rabbit | AB_10823958 | Antibodies-Online | ABIN213766 | 2025-08-19 10:32:14 | 0 | ||
|
Rabbit Anti-FGFR1 Polyclonal Antibody, Unconjugated Resource Report Resource Website |
Abnova Cat# PAB11876, RRID:AB_1675067 | FGFR1 | manufacturer recommendations: Immunohistochemistry; Immunohistochemistry-P | polyclonal | rabbit | AB_1675067 | Abnova | PAB11876 | 2025-08-19 10:32:18 | 0 | |||
|
PAX6 antibody [EPR3352(2)] Resource Report Resource Website 1+ mentions |
Abcam Cat# ab109233, RRID:AB_10861257 | PAX6 antibody [EPR3352(2)] | rat, mouse, human | validation status unknown, seller recommendations provided in 2012: Flow Cytometry; Western Blot; Flow Cyt, WB | monoclonal | rabbit | AB_10861257 | Abcam | ab109233 | 2025-08-19 10:32:21 | 2 | ||
|
Anti-TBC1D3L polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA052553, RRID:AB_2681869 | TBC1D3L | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681869 | Atlas Antibodies | HPA052553 | 2025-08-19 10:32:13 | 0 | ||
|
Rabbit Anti-CD282 / TLR2 Antibody, Unconjugated Resource Report Resource Website |
Acris Antibodies Cat# AP09340PU-N, RRID:AB_2035301 | CD282 / TLR2 | mouse, human | manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; ELISA, Paraffin sections, Western Blot | unknown | rabbit | AB_2035301 | Acris Antibodies | AP09340PU-N | 2025-08-19 10:31:55 | 0 | ||
|
Anti-CFAP77 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 | CFAP77 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10601126 | Atlas Antibodies | HPA024647 | 2025-08-19 10:32:11 | 0 | ||
|
Rabbit Anti-ErbB-2 (Her-2), phospho (Tyr1248) Polyclonal Antibody, Unconjugated Resource Report Resource Website |
AnaSpec; EGT Group Cat# 29607-025, RRID:AB_1091590 | ErbB-2 (Her-2), phospho (Tyr1248) | mouse, human | manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; Immunohistochemistry, Western Blot, ELISA | polyclonal | rabbit | AB_1091590 | AnaSpec; EGT Group | 29607-025 | 2025-08-19 10:31:50 | 0 | ||
|
Anti-CMC2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 | CMC2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845581 | Atlas Antibodies | HPA006871 | 2025-08-19 10:32:11 | 0 | ||
|
MOB4 Polyclonal Antibody Resource Report Resource Website |
ABclonal Cat# A4590, RRID:AB_2765772 | MOB4 | rat, mouse, human | Applications:WB | polyclonal | rabbit | AB_2765772 | ABclonal | A4590 | 2025-08-19 10:32:19 | 0 | ||
|
Rabbit Anti-Human Human IgE Polyclonal, Unconjugated Resource Report Resource Website |
LSBio (LifeSpan) Cat# LS-C68500-250, RRID:AB_1652990 | Human Human IgE | human | vendor suggested use: Immunohistochemistry; Immunohistochemistry (Parrafin) | polyclonal | rabbit | AB_1652990 | LSBio (LifeSpan) | LS-C68500-250 | 2025-08-19 10:31:51 | 0 | ||
|
ZNF300 Antibody Resource Report Resource Website |
Abbiotec Cat# 250541, RRID:AB_2304710 | ZNF300 | rat, h, m, mouse, r, human | manufacturer recommendations: IgG Immunohistochemistry; Western Blot; ELISA; E, WB, IHC | polyclonal | rabbit | AB_2304710 | Abbiotec | 250541 | 2025-08-19 10:31:52 | 0 | ||
|
Rabbit Anti-Mouse Focal Adhesion Kinase 1 (PTK2, FAK1) Polyclonal, Unconjugated Resource Report Resource Website |
LSBio (LifeSpan) Cat# LS-C41215-50, RRID:AB_1192027 | Mouse Focal Adhesion Kinase 1 (PTK2, FAK1) | mouse, human | vendor suggested use: Western Blot; Western Blot | polyclonal | rabbit | AB_1192027 | LSBio (LifeSpan) | LS-C41215-50 | 2025-08-19 10:32:11 | 0 | ||
|
Rabbit Anti-Gclc Polyclonal Antibody Resource Report Resource Website Discontinued |
Creative Biomart Cat# DPABT-H10262, RRID:AB_11393058 | Gclc | human | Discontinued: 2015; Discontinued on 27 July 2015; IHC-P | polyclonal | rabbit | AB_11393058 | Creative Biomart | DPABT-H10262 | 2025-08-19 10:32:14 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.