Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078559
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): COX4I1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA002485, RRID:AB_1078559 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851474
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007993, RRID:AB_1851474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849497
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): GAS6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA008275, RRID:AB_1849497 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079043
Comments: Vendor recommendations: Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): DNAJA1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA001306, RRID:AB_1079043 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2249331
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): JAKMIP3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA022872, RRID:AB_2249331 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855134
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIV; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): PDGFB
Proper citation: Atlas Antibodies Cat# HPA011972, RRID:AB_1855134 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856592
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SAT2
Proper citation: Atlas Antibodies Cat# HPA022136, RRID:AB_1856592 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856610
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SCD
Proper citation: Atlas Antibodies Cat# HPA012107, RRID:AB_1856610 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601701
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TOX4
Proper citation: Atlas Antibodies Cat# HPA027551, RRID:AB_10601701 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10797034
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SNX24 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044566, RRID:AB_10797034 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846453
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human CDON
Proper citation: Sigma-Aldrich Cat# HPA017377, RRID:AB_1846453 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845080
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ASGR1
Proper citation: Atlas Antibodies Cat# HPA012852, RRID:AB_1845080 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602684
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ZFP30 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030606, RRID:AB_10602684 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845062
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ASAH1
Proper citation: Atlas Antibodies Cat# HPA005468, RRID:AB_1845062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795463
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ZC3H10 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA039236, RRID:AB_10795463 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10797034
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SNX24 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044566, RRID:AB_10797034 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854633
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NRARP
Proper citation: Atlas Antibodies Cat# HPA025729, RRID:AB_1854633 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_732419
Comments: Applications: ELISA, IHC
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: goat
Clonality unknown
Target(s): FOXN1
Proper citation: Antibodies.com Cat# A83957, RRID:AB_732419 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854385
Comments: Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): NEU1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021506, RRID:AB_1854385 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10952692
Comments: Discontinued; Applications: WB (1:1,000-1:2,500), IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): IRF5
Proper citation: Thermo Fisher Scientific Cat# A303-386A, RRID:AB_10952692 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
