Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963577
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GSPT2
Proper citation: Atlas Antibodies Cat# HPA044769, RRID:AB_10963577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601266
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SREBF2
Proper citation: Atlas Antibodies Cat# HPA031962, RRID:AB_10601266 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678587
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OSBP
Proper citation: Atlas Antibodies Cat# HPA043625, RRID:AB_2678587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681750
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C7orf26
Proper citation: Atlas Antibodies Cat# HPA052175, RRID:AB_2681750 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682474
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RAB11B
Proper citation: Atlas Antibodies Cat# HPA054396, RRID:AB_2682474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686445
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SIRT6
Proper citation: Atlas Antibodies Cat# HPA071776, RRID:AB_2686445 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677393
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BOD1L1
Proper citation: Atlas Antibodies Cat# HPA041290, RRID:AB_2677393 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794863
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GRXCR1
Proper citation: Atlas Antibodies Cat# HPA040824, RRID:AB_10794863 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794798
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COL19A1
Proper citation: Atlas Antibodies Cat# HPA042422, RRID:AB_10794798 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676355
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF662
Proper citation: Atlas Antibodies Cat# HPA039116, RRID:AB_2676355 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852224
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): KRT20
Proper citation: Atlas Antibodies Cat# HPA027236, RRID:AB_1852224 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685461
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSV; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): CASKIN2
Proper citation: Atlas Antibodies Cat# HPA065308, RRID:AB_2685461 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844637
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRY; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): AFMID
Proper citation: Atlas Antibodies Cat# HPA026536, RRID:AB_1844637 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2756310
Comments: Originating manufacturer of this product. Applications: WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s):
Proper citation: Atlas Antibodies Cat# HPA041721, RRID:AB_2756310 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10597874
Comments: manufacturer recommendations: Radioimmunoassay; Immunoprecipitation; Western Blot; WB, IPP, RIP
Host Organism: rabbit
Clonality unknown
Target(s): CPEB1
Proper citation: MBL International Cat# RN038P, RRID:AB_10597874 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_354451
Comments: Applications: Western Blot, Immunohistochemistry, Neutralization
Host Organism: Goat
Clonality polyclonal
Target(s): HGF
Proper citation: R and D Systems Cat# AF-294-NA, RRID:AB_354451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846282
Comments: Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MUC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA004179, RRID:AB_1846282 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671579
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): UPK1B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031799, RRID:AB_10671579 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669782
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TGFBRAP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038397, RRID:AB_10669782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10697714
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): RNASEH2B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040084, RRID:AB_10697714 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.