Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-MYO1D polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA054744, RRID:AB_2682589 | MYO1D | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYK; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_2682589 | Atlas Antibodies | HPA054744 | 2025-08-20 01:47:00 | 0 | ||
|
Anti-PARP10 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA052427, RRID:AB_2681828 | PARP10 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681828 | Atlas Antibodies | HPA052427 | 2025-08-20 01:47:00 | 0 | ||
|
Anti-ARL1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA062656, RRID:AB_2684821 | ARL1 | human | Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684821 | Atlas Antibodies | HPA062656 | 2025-08-20 01:47:01 | 0 | ||
|
Anti-COL9A2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA056316, RRID:AB_2683099 | COL9A2 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683099 | Atlas Antibodies | HPA056316 | 2025-08-20 01:47:08 | 0 | ||
|
Anti-LGSN Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA039983, RRID:AB_2676784 | LGSN | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2676784 | Atlas Antibodies | HPA039983 | 2025-08-20 01:47:08 | 0 | ||
|
Anti-USP31 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006937, RRID:AB_1080523 | USP31 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1080523 | Atlas Antibodies | HPA006937 | 2025-08-20 01:47:04 | 0 | ||
|
Anti-SMCR8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024646, RRID:AB_1857284 | SMCR8 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1857284 | Atlas Antibodies | HPA024646 | 2025-08-20 01:47:06 | 0 | ||
|
Anti-VARS polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA046710, RRID:AB_2679765 | VARS | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679765 | Atlas Antibodies | HPA046710 | 2025-08-20 01:47:00 | 0 | ||
|
Anti-AZGP1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012582, RRID:AB_1845226 | Human AZGP1 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1845226 | Sigma-Aldrich | HPA012582 | 2025-08-20 01:55:21 | 0 | ||
|
Anti-PTPN6 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA001466, RRID:AB_1855930 | Human PTPN6 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1855930 | Sigma-Aldrich | HPA001466 | 2025-08-20 01:55:59 | 0 | ||
|
Human BACH1 Antibody Resource Report Resource Website 1+ mentions Rating or validation data |
R and D Systems Cat# AF5776, RRID:AB_2061974 | BACH1 | Human | Applications: Western Blot, Immunohistochemistry | polyclonal | Goat | AB_2061974 | R and D Systems | AF5776 (also AF5776-SP) | 2025-08-20 01:55:21 | 3 | ||
|
Mouse Anti-DRBP76 Monoclonal Antibody, Unconjugated, Clone 21 Resource Report Resource Website Rating or validation data |
BD Biosciences Cat# 612155, RRID:AB_399526 | DRBP76 | human | Applications: Western blot, Immunofluorescence | monoclonal | mouse | AB_399526 | BD Biosciences | 612155 | 2025-08-20 01:55:57 | 0 | ||
|
Anti-TMEM200A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA014396, RRID:AB_2204904 | TMEM200A | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_2204904 | Sigma-Aldrich | HPA014396 | 2025-08-20 01:55:20 | 0 | ||
|
Anti-OBSCN antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA021186, RRID:AB_1854761 | OBSCN antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1854761 | Sigma-Aldrich | HPA021186 | 2025-08-20 01:56:01 | 0 | ||
|
Anti-SLC39A5 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA018423, RRID:AB_1857154 | SLC39A5 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1857154 | Sigma-Aldrich | HPA018423 | 2025-08-20 01:56:00 | 0 | ||
|
Anti-TMPRSS11F antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA026911, RRID:AB_2205589 | TMPRSS11F antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_2205589 | Sigma-Aldrich | HPA026911 | 2025-08-20 01:56:00 | 0 | ||
|
Anti-OTOF antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012410, RRID:AB_1854836 | OTOF antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1854836 | Sigma-Aldrich | HPA012410 | 2025-08-20 01:56:01 | 0 | ||
|
Anti-PTPRN2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA026656, RRID:AB_1855912 | Human PTPRN2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1855912 | Sigma-Aldrich | HPA026656 | 2025-08-20 01:55:32 | 0 | ||
|
GATA-4 (H-112) Resource Report Resource Website 10+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-9053, RRID:AB_2247396 | GATA-4 (H-112) | rat, goat, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; WB, IP, IF, ELISA; Immunofluorescence; Western Blot; Immunoprecipitation | polyclonal | human | AB_2247396 | Santa Cruz Biotechnology | sc-9053 | 2025-08-20 01:56:03 | 14 | ||
|
PECAM-1 (M-20) Resource Report Resource Website 10+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-1506, RRID:AB_2161037 | epitope mapping at the C-terminus of PECAM-1 of human origin | mouse, human |
Discontinued: 2016; Used By NYUIHC-1165 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
unknown | goat | AB_2161037 | Santa Cruz Biotechnology | sc-1506 | 2025-08-20 01:55:53 | 13 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
