Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682589
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYK; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): MYO1D
Proper citation: Atlas Antibodies Cat# HPA054744, RRID:AB_2682589 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681828
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PARP10
Proper citation: Atlas Antibodies Cat# HPA052427, RRID:AB_2681828 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684821
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ARL1
Proper citation: Atlas Antibodies Cat# HPA062656, RRID:AB_2684821 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683099
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COL9A2
Proper citation: Atlas Antibodies Cat# HPA056316, RRID:AB_2683099 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676784
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LGSN
Proper citation: Atlas Antibodies Cat# HPA039983, RRID:AB_2676784 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080523
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): USP31
Proper citation: Atlas Antibodies Cat# HPA006937, RRID:AB_1080523 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857284
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SMCR8
Proper citation: Atlas Antibodies Cat# HPA024646, RRID:AB_1857284 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679765
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VARS
Proper citation: Atlas Antibodies Cat# HPA046710, RRID:AB_2679765 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845226
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human AZGP1
Proper citation: Sigma-Aldrich Cat# HPA012582, RRID:AB_1845226 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855930
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PTPN6
Proper citation: Sigma-Aldrich Cat# HPA001466, RRID:AB_1855930 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2061974
Comments: Applications: Western Blot, Immunohistochemistry
Host Organism: Goat
Clonality polyclonal
Target(s): BACH1
Proper citation: R and D Systems Cat# AF5776, RRID:AB_2061974 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_399526
Comments: Applications: Western blot, Immunofluorescence
Host Organism: mouse
Clonality monoclonal
Target(s): DRBP76
Proper citation: BD Biosciences Cat# 612155, RRID:AB_399526 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2204904
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): TMEM200A
Proper citation: Sigma-Aldrich Cat# HPA014396, RRID:AB_2204904 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854761
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): OBSCN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021186, RRID:AB_1854761 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857154
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC39A5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018423, RRID:AB_1857154 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2205589
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TMPRSS11F antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026911, RRID:AB_2205589 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854836
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): OTOF antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012410, RRID:AB_1854836 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855912
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PTPRN2
Proper citation: Sigma-Aldrich Cat# HPA026656, RRID:AB_1855912 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2247396
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; WB, IP, IF, ELISA; Immunofluorescence; Western Blot; Immunoprecipitation
Host Organism: human
Clonality polyclonal
Target(s): GATA-4 (H-112)
Proper citation: Santa Cruz Biotechnology Cat# sc-9053, RRID:AB_2247396 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2161037
Comments: Discontinued: 2016; Used By NYUIHC-1165
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: goat
Clonality unknown
Target(s): epitope mapping at the C-terminus of PECAM-1 of human origin
Proper citation: Santa Cruz Biotechnology Cat# sc-1506, RRID:AB_2161037 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
