Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-ZNF582 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA028858, RRID:AB_10603247 | ZNF582 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10603247 | Sigma-Aldrich | HPA028858 | 2025-08-19 08:01:14 | 0 | ||
|
Anti-PKDREJ antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA034587, RRID:AB_10670570 | PKDREJ antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10670570 | Sigma-Aldrich | HPA034587 | 2025-08-19 08:01:30 | 0 | ||
|
Anti-CCDC22 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA000888, RRID:AB_1078420 | CCDC22 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry; Immunofluorescence | polyclonal | rabbit | AB_1078420 | Sigma-Aldrich | HPA000888 | 2025-08-19 08:01:16 | 0 | ||
|
Anti-SAMD9L antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA019465, RRID:AB_2183384 | SAMD9L antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot | polyclonal | rabbit | AB_2183384 | Sigma-Aldrich | HPA019465 | 2025-08-19 08:01:29 | 0 | ||
|
Keratin, type I; cytokeratin 19 antibody - Kemler, R.; MPI fuer Immunobiologie Resource Report Resource Website 50+ mentions Rating or validation data |
DSHB Cat# TROMA-III, RRID:AB_2133570 | Keratin, type I; cytokeratin 19 | mouse, human |
PMID:6171607 PMID:23006330 PMID:23376645 PMID:21712022 PMID:24700364 PMID:20546735 PMID:6933460 PMID:19747186 PMID:20621380 PMID:21220329 |
Application(s): FFPE,Immunofluorescence,Immunohistochemistry,Immunoprecipitation,Western Blot; Date Deposited: 12/22/2004 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE |
monoclonal | rat | AB_2133570 | DSHB | TROMA-III | 2025-08-19 08:01:28 | 70 | |
|
Anti-NEK8 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040679, RRID:AB_10796226 | NEK8 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10796226 | Sigma-Aldrich | HPA040679 | 2025-08-19 08:01:40 | 0 | ||
|
Anti-FUS polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA008784, RRID:AB_1849181 | FUS | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1849181 | Atlas Antibodies | HPA008784 | 2025-08-19 08:01:39 | 7 | ||
|
Anti-IL33 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA052386, RRID:AB_2681809 | IL33 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKL; Manufacturer approved use: ICC-IF | polyclonal | rabbit | AB_2681809 | Atlas Antibodies | HPA052386 | 2025-08-19 08:01:40 | 0 | ||
|
Anti-USP25 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA018297, RRID:AB_1858672 | USP25 | human | Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1858672 | Atlas Antibodies | HPA018297 | 2025-08-19 08:01:38 | 0 | ||
|
Anti-KBTBD7 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA043709, RRID:AB_10961260 | KBTBD7 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10961260 | Atlas Antibodies | HPA043709 | 2025-08-19 08:01:39 | 0 | ||
|
Anti-C10orf85 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037933, RRID:AB_10672614 | C10orf85 antibody produced in rabbit | human | polyclonal | rabbit | AB_10672614 | Atlas Antibodies | HPA037933 | 2025-08-19 08:01:46 | 0 | |||
|
Anti-CCDC80 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA002266, RRID:AB_1078423 | Human CCDC80 | human | Vendor recommendations: | unknown | rabbit | AB_1078423 | Sigma-Aldrich | HPA002266 | 2025-08-19 08:01:51 | 0 | ||
|
Anti-PARP14 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012063, RRID:AB_1854981 | Human PARP14 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854981 | Sigma-Aldrich | HPA012063 | 2025-08-19 08:01:53 | 0 | ||
|
Anti-PDZD11 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA003972, RRID:AB_1855165 | Human PDZD11 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1855165 | Sigma-Aldrich | HPA003972 | 2025-08-19 08:01:55 | 0 | ||
|
insulin (proinsulin; C-peptide) antibody - Madsen, O.D.; Hagedorn Research Institute Resource Report Resource Website 10+ mentions Rating or validation data |
DSHB Cat# GN-ID4, RRID:AB_2255626 | insulin (proinsulin; C-peptide) | monkey, human |
PMID:8855374 PMID:23468018 PMID:26515645 PMID:2842785 PMID:1682130 PMID:2443408 PMID:26216140 PMID:8785515 PMID:29249360 PMID:842785 PMID:6196183 |
Application(s): FACS,Immunofluorescence,Immunohistochemistry,Immunoprecipitation; Date Deposited: 01/23/2006 | monoclonal | rat | AB_2255626 | DSHB | GN-ID4 | 2025-08-19 07:59:41 | 36 | |
|
Peroxisome Proliferator-Activated Receptor gamma Resource Report Resource Website 1+ mentions Rating or validation data |
Cell Signaling Technology Cat# 2492, RRID:AB_2335662 | ND |
Used By NYUIHC-373 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
unknown | rabbit | AB_2335662 | Cell Signaling Technology | 2492 | 2025-08-19 07:59:55 | 2 | |||
|
Anti-DEPDC5 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA054969, RRID:AB_2682655 | DEPDC5 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682655 | Atlas Antibodies | HPA054969 | 2025-08-19 08:00:11 | 1 | ||
|
Anti-KIAA1328 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA040946, RRID:AB_10794998 | KIAA1328 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10794998 | Atlas Antibodies | HPA040946 | 2025-08-19 07:59:53 | 0 | ||
|
Anti-SATL1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA060369, RRID:AB_2684265 | SATL1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684265 | Atlas Antibodies | HPA060369 | 2025-08-19 08:00:11 | 0 | ||
|
Anti-OCEL1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA042070, RRID:AB_2677830 | OCEL1 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2677830 | Atlas Antibodies | HPA042070 | 2025-08-19 08:00:10 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.