Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852380
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CAMSAP2
Proper citation: Atlas Antibodies Cat# HPA027302, RRID:AB_1852380 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2116671
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HHATL
Proper citation: Atlas Antibodies Cat# HPA018174, RRID:AB_2116671 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857461
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CHP1
Proper citation: Atlas Antibodies Cat# HPA006616, RRID:AB_1857461 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600835
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TTLL5
Proper citation: Atlas Antibodies Cat# HPA032128, RRID:AB_10600835 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844509
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PXYLP1
Proper citation: Atlas Antibodies Cat# HPA017243, RRID:AB_1844509 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079497
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NOVA1
Proper citation: Atlas Antibodies Cat# HPA004155, RRID:AB_1079497 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601478
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GNA13
Proper citation: Atlas Antibodies Cat# HPA010087, RRID:AB_10601478 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078995
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIP11
Proper citation: Atlas Antibodies Cat# HPA002570, RRID:AB_1078995 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856959
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC10A5
Proper citation: Atlas Antibodies Cat# HPA025966, RRID:AB_1856959 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854736
Comments: Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): NXN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA022850, RRID:AB_1854736 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854645
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): NRK antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017238, RRID:AB_1854645 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848542
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): FHL1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA001391, RRID:AB_1848542 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845258
Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): BAG3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020586, RRID:AB_1845258 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855631
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PPM1L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019891, RRID:AB_1855631 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2297599
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): MFSD11
Proper citation: Sigma-Aldrich Cat# HPA022001, RRID:AB_2297599 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849149
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Western Blot; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): FRMD5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA013961, RRID:AB_1849149 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2097451
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SHIESLRNSARRKWLHQIQCAAETSGVSLEPVYSETFKALMQDAEAHGNKKISAHISLLEENLLLPEKGNVLLRNVACTLDDAQFVLNRVLYRDMKGISFTVVDEGKPIHVPQVQ; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): EFCAB5
Proper citation: Atlas Antibodies Cat# HPA028608, RRID:AB_2097451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2106672
Comments: manufacturer recommendations: Western Blot; Immunohistochemistry; Western blot,Immunohistochemistry (Paraffin),Western Blotting:,Western Blotting:; The following antibodies were determined to be duplicates and consolidated by curator on 10/2018: AB_10693643, AB_2106672.
Host Organism: rabbit
Clonality polyclonal
Target(s): FoxO3a
Proper citation: Cell Signaling Technology Cat# 9467, RRID:AB_2106672 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2739371
Comments: Applications: Intracellular staining (flow cytometry), Immunofluorescence, Immunohistochemistry-paraffin
Host Organism: mouse
Clonality monoclonal
Target(s): C-Peptide
Proper citation: BD Biosciences Cat# 565831, RRID:AB_2739371 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682271
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ADAMTSL2
Proper citation: Atlas Antibodies Cat# HPA053812, RRID:AB_2682271 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.