Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858795
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human WDR13
Proper citation: Sigma-Aldrich Cat# HPA000913, RRID:AB_1858795 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856012
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): ERC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019513, RRID:AB_1856012 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_937919
Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): MYBBP1A
Proper citation: Bethyl Cat# A301-328A, RRID:AB_937919 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080579
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): VRK1
Proper citation: Atlas Antibodies Cat# HPA000660, RRID:AB_1080579 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845526
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C11orf24
Proper citation: Atlas Antibodies Cat# HPA012748, RRID:AB_1845526 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600865
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CRYZL1
Proper citation: Atlas Antibodies Cat# HPA029399, RRID:AB_10600865 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855967
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PXK
Proper citation: Atlas Antibodies Cat# HPA024068, RRID:AB_1855967 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858425
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TTC14
Proper citation: Atlas Antibodies Cat# HPA009295, RRID:AB_1858425 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853444
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LYZL6
Proper citation: Atlas Antibodies Cat# HPA025734, RRID:AB_1853444 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844453
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ABL1
Proper citation: Atlas Antibodies Cat# HPA027251, RRID:AB_1844453 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676430
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPTBN2
Proper citation: Atlas Antibodies Cat# HPA039293, RRID:AB_2676430 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686266
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP5J2
Proper citation: Atlas Antibodies Cat# HPA070412, RRID:AB_2686266 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672678
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GPR52
Proper citation: Atlas Antibodies Cat# HPA028575, RRID:AB_2672678 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2753159
Comments: Applications: Immunoprecipitation, WB, ChIP-Seq
Host Organism: mouse
Clonality monoclonal
Target(s): ZNF410
Proper citation: CDI Cat# m14-038, RRID:AB_2753159 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2203924
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGCSWMPDITLIHAGGLAQAQFSHIGASLHARTAYVYRVPEEAK; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): TM6SF1
Proper citation: Atlas Antibodies Cat# HPA016051, RRID:AB_2203924 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854385
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NEU1
Proper citation: Atlas Antibodies Cat# HPA021506, RRID:AB_1854385 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2144182
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): METRNL
Proper citation: Sigma-Aldrich Cat# HPA023792, RRID:AB_2144182 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855630
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PPM1K
Proper citation: Sigma-Aldrich Cat# HPA023891, RRID:AB_1855630 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852652
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): KTN1
Proper citation: Atlas Antibodies Cat# HPA017876, RRID:AB_1852652 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856151
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human EBAG9
Proper citation: Sigma-Aldrich Cat# HPA021153, RRID:AB_1856151 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.