Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2047736
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC9857 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615113, AB_2047736.
Host Organism: rabbit
Clonality unknown
Target(s): RBMXL2
Proper citation: Aviva Systems Biology Cat# ARP40773_P050, RRID:AB_2047736 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854139
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MS4A8B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007318, RRID:AB_1854139 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855545
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POPDC2
Proper citation: Atlas Antibodies Cat# HPA024255, RRID:AB_1855545 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080570
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VCL
Proper citation: Atlas Antibodies Cat# HPA002131, RRID:AB_1080570 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10966437
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): C9orf86 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044037, RRID:AB_10966437 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852567
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): KLHL1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021196, RRID:AB_1852567 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846162
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC57 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023344, RRID:AB_1846162 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10895401
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): HLXB9
Proper citation: Thermo Fisher Scientific Cat# A303-184A, RRID:AB_10895401 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794656
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): C19orf24 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043279, RRID:AB_10794656 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845647
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTE; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): C1orf54
Proper citation: Atlas Antibodies Cat# HPA026518, RRID:AB_1845647 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10857128
Comments: Used By NYUIHC-1406
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): MEK2
Proper citation: Bioss Cat# bs-0223R, RRID:AB_10857128 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844843
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ANKRD40
Proper citation: Atlas Antibodies Cat# HPA021668, RRID:AB_1844843 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853702
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ME2
Proper citation: Atlas Antibodies Cat# HPA008880, RRID:AB_1853702 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855080
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PCNT
Proper citation: Atlas Antibodies Cat# HPA019887, RRID:AB_1855080 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857712
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SDCBP
Proper citation: Atlas Antibodies Cat# HPA023840, RRID:AB_1857712 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853680
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MDH2
Proper citation: Atlas Antibodies Cat# HPA019716, RRID:AB_1853680 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1850715
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HINT2
Proper citation: Atlas Antibodies Cat# HPA020961, RRID:AB_1850715 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845603
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAAP100
Proper citation: Atlas Antibodies Cat# HPA026532, RRID:AB_1845603 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611523
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): XPNPEP1
Proper citation: Atlas Antibodies Cat# HPA030420, RRID:AB_10611523 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_648559
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: Immunofluorescence; ELISA; Western Blot; WB, IHC
Host Organism: goat
Clonality polyclonal
Target(s): HRT1 (C-20)
Proper citation: Santa Cruz Biotechnology Cat# sc-16424, RRID:AB_648559 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
