Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 221 showing 4401 ~ 4420 out of 55,392 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10960989

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): CTDSPL2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA040763, RRID:AB_10960989 Copy   

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10954133

Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): TSC22D4

Proper citation: Bethyl Cat# A303-222A, RRID:AB_10954133 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844524

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ACOT7

Proper citation: Sigma-Aldrich Cat# HPA025762, RRID:AB_1844524 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10673012

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): OVOL2

Proper citation: Atlas Antibodies Cat# HPA038531, RRID:AB_10673012 Copy   

    • RRID:AB_10796336

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796336

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): WDR61

Proper citation: Atlas Antibodies Cat# HPA039932, RRID:AB_10796336 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671101

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MAML2

Proper citation: Atlas Antibodies Cat# HPA035223, RRID:AB_10671101 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672862

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FGFR2

Proper citation: Atlas Antibodies Cat# HPA035305, RRID:AB_10672862 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794666

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C16orf46

Proper citation: Atlas Antibodies Cat# HPA041379, RRID:AB_10794666 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685295

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGA; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): NRL

Proper citation: Atlas Antibodies Cat# HPA064599, RRID:AB_2685295 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683827

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BRAP

Proper citation: Atlas Antibodies Cat# HPA058820, RRID:AB_2683827 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796907

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PLP2

Proper citation: Atlas Antibodies Cat# HPA042415, RRID:AB_10796907 Copy   

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_817904

Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): SMARCA2/BRM

Proper citation: Bethyl Cat# A301-015A, RRID:AB_817904 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847990

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LPAR3

Proper citation: Atlas Antibodies Cat# HPA013421, RRID:AB_1847990 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684788

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF781

Proper citation: Atlas Antibodies Cat# HPA062512, RRID:AB_2684788 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682982

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OR6K3

Proper citation: Atlas Antibodies Cat# HPA055949, RRID:AB_2682982 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682389

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF136

Proper citation: Atlas Antibodies Cat# HPA054120, RRID:AB_2682389 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078914

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FTSJ1

Proper citation: Atlas Antibodies Cat# HPA002718, RRID:AB_1078914 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2676385

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LATS2

Proper citation: Atlas Antibodies Cat# HPA039191, RRID:AB_2676385 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795365

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): OTOGL antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA040364, RRID:AB_10795365 Copy   

    • RRID:AB_2675945

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675945

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): BLNK

Proper citation: Sigma-Aldrich Cat# HPA038309, RRID:AB_2675945 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch